[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39447.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  277/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:315 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  56->163 1s7bA  f.39.1.1 * 7e-07 15.7 %
:HMM:SCOP  59->164 1s7bA_ f.39.1.1 * 1e-13 26.7 %
:HMM:SCOP  199->303 1s7bA_ f.39.1.1 * 5.4e-14 17.1 %
:HMM:PFM   36->156 PF00892 * EamA 7.1e-18 27.3 121/126  
:HMM:PFM   175->294 PF00892 * EamA 1.3e-10 17.5 120/126  
:BLT:SWISS 26->299 SAM_RICBR 4e-31 27.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39447.1 GT:GENE ABE39447.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2475526..2476473 GB:FROM 2475526 GB:TO 2476473 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF6, transmembrane GB:PROTEIN_ID ABE39447.1 GB:DB_XREF GI:91683145 InterPro:IPR000620 LENGTH 315 SQ:AASEQ MTITSPPVTDAARRLTQRHADHPLRGIALIVASTVFLACSDTLAKYLGRTLPPIEIGWIRFLVFLLIMLPVALASSESPLRSVRPKLQVLRALALVASSVLFITGLRFLPIAEASATSFVAPLFVTALSIVLLGEAIGIRRWVATLVGLIGVLIVIRPGSSTFNPAVILPILSALCWAITLILTRMISGADRAVVTMTFSALVGFLALSAMVPFVWVTPSWTDIAIGVGVGLASTIGQWIVVLAFRYADASALAPFSYSQLLWVTILGYAVFSEIPDAWTFVGAVVIICSGVYIAHRERLRRKQNVAPAEPNPNP GT:EXON 1|1-315:0| BL:SWS:NREP 1 BL:SWS:REP 26->299|SAM_RICBR|4e-31|27.0|274/291| TM:NTM 10 TM:REGION 22->44| TM:REGION 56->78| TM:REGION 86->108| TM:REGION 112->134| TM:REGION 142->164| TM:REGION 168->190| TM:REGION 196->218| TM:REGION 224->246| TM:REGION 252->274| TM:REGION 276->297| SEG 87->101|lqvlralalvassvl| HM:PFM:NREP 2 HM:PFM:REP 36->156|PF00892|7.1e-18|27.3|121/126|EamA| HM:PFM:REP 175->294|PF00892|1.3e-10|17.5|120/126|EamA| RP:SCP:NREP 1 RP:SCP:REP 56->163|1s7bA|7e-07|15.7|102/106|f.39.1.1| HM:SCP:REP 59->164|1s7bA_|1e-13|26.7|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 199->303|1s7bA_|5.4e-14|17.1|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 636 OP:NHOMOORG 298 OP:PATTERN ----------------------------------------11-------------------------- ---------------------1-----------111------------------------------------------------------------3----------1----------------------1----1-11--------1-----11----1--1--------111-11111-111-------------------------------1-----------------1--------------1111------------------------------------------------------------------------11----------------2222-2-----1-----------------1----2113-----11333---2233233333332337-1111111139--6887785A99872222-8DA78879EH11111111---2-143---------11211111111111111-2-31212124313-------------12------1-1111--1--11-111-12221----2--------------11-----1------11------------------------------1111111111---1--22--1-32-1113333-21222112121------------------1------------------------------------1-------------------------------11111111111-----1--------1222111--------1---11-1-11--23-33331211111111111----------2332122125434422333333331111--1------------------------------------------------------1- ----21-----------1--------------------------------------------1--------------------------------1-------111--1-2--------------------------------------------------------------2----11111--------1--1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18,299-316| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //