[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39448.1
DDBJ      :             transcriptional regulator, AsnC family
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  522/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->153 2p6tF PDBj 1e-27 39.2 %
:RPS:PDB   4->153 2e1cA PDBj 4e-29 30.1 %
:RPS:SCOP  4->63 1i1gA1  a.4.5.32 * 3e-19 40.0 %
:RPS:SCOP  66->152 2cg4A2  d.58.4.2 * 6e-22 29.4 %
:HMM:SCOP  2->64 2cg4A1 a.4.5.32 * 1.1e-19 52.4 %
:HMM:SCOP  64->153 1ri7A2 d.58.4.2 * 7.9e-24 47.7 %
:RPS:PFM   8->49 PF08279 * HTH_11 2e-05 52.4 %
:RPS:PFM   82->142 PF01037 * AsnC_trans_reg 2e-11 45.9 %
:HMM:PFM   70->144 PF01037 * AsnC_trans_reg 8.5e-28 43.2 74/74  
:HMM:PFM   10->61 PF01047 * MarR 3.6e-07 34.6 52/59  
:BLT:SWISS 1->153 BKDR_PSEPU 4e-35 50.7 %
:PROS 22->48|PS00519|HTH_ASNC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39448.1 GT:GENE ABE39448.1 GT:PRODUCT transcriptional regulator, AsnC family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2476611..2477072) GB:FROM 2476611 GB:TO 2477072 GB:DIRECTION - GB:PRODUCT transcriptional regulator, AsnC family GB:PROTEIN_ID ABE39448.1 GB:DB_XREF GI:91683146 InterPro:IPR000485 LENGTH 153 SQ:AASEQ MPDLDAIDRKILASLQADGRTTMQELADKVGLSVSPCHRRVKLLESRGVITRYTALVDQKAIGLHVSVFISIKLVRQKEEDLNRFARAISKWDEVLECYLMTGNRDYLLRVVAADLAAYEAFLKNKLTRLDGIASIESSFALSQVKYSIALPV GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 1->153|BKDR_PSEPU|4e-35|50.7|152/161| PROS 22->48|PS00519|HTH_ASNC_1|PDOC00520| BL:PDB:NREP 1 BL:PDB:REP 4->153|2p6tF|1e-27|39.2|148/154| RP:PDB:NREP 1 RP:PDB:REP 4->153|2e1cA|4e-29|30.1|146/147| RP:PFM:NREP 2 RP:PFM:REP 8->49|PF08279|2e-05|52.4|42/52|HTH_11| RP:PFM:REP 82->142|PF01037|2e-11|45.9|61/74|AsnC_trans_reg| HM:PFM:NREP 2 HM:PFM:REP 70->144|PF01037|8.5e-28|43.2|74/74|AsnC_trans_reg| HM:PFM:REP 10->61|PF01047|3.6e-07|34.6|52/59|MarR| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 4->63|1i1gA1|3e-19|40.0|60/60|a.4.5.32| RP:SCP:REP 66->152|2cg4A2|6e-22|29.4|85/86|d.58.4.2| HM:SCP:REP 2->64|2cg4A1|1.1e-19|52.4|63/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 64->153|1ri7A2|7.9e-24|47.7|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 2549 OP:NHOMOORG 577 OP:PATTERN ---1-13-333333312-111112-111-211-1-121-1-11--1111-111-5555666--14-11 -21-A---222---41134-33--3133333422222666121152-1-11-764132--7651627885-1----11----------2232-3111--21624343516---------------11111111111-----111-1---1----------------1----------------422-----1-23333334234232242433242421122111------42---------------------------1---1111-----------------------------------------------------------3---1-111112211----21----122-331-1-1-1111-----2--98851111142A6A222544737777777677A-116119156I2-HBBCFFSHHIDC836436AF9A888GH2222222246631177------------------------------17H65ABBABNKLLOMFCCCBFGEEFFFF9EGKG7899-177A489787593B2333----622222212---141--1-111--12----1-1----------21---------------------------11554321628623344323522224354233--1----------34563343333333333-3333333333333333333657344444345444454354555733333332-544444444444---3-----2222-173D2222422333312229A888751213288889C6D58B783899---------244445455497B764422222222------------------------------------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----3------1--1--------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 100.0 SQ:SECSTR cccccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHGHHHHHHHHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHcTTEEEEEEEEccccccccccccc DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEEEcHHHcccccEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccc //