[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39455.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->60 PF00839 * Cys_rich_FGFR 1.3e-05 28.6 28/58  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39455.1 GT:GENE ABE39455.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2486234..2486545 GB:FROM 2486234 GB:TO 2486545 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39455.1 GB:DB_XREF GI:91683153 LENGTH 103 SQ:AASEQ MPSRTLTSAIALTTLLGSGAALAQERGSEAQREACTPDALRLCSQYIPDAGRIESCLRDAGPRLSQACYVVFHPPSETRAPPMRTVRRQQRPPQQQVEDVENQ GT:EXON 1|1-103:0| SEG 5->23|tltsaialttllgsgaala| SEG 81->96|ppmrtvrrqqrppqqq| HM:PFM:NREP 1 HM:PFM:REP 33->60|PF00839|1.3e-05|28.6|28/58|Cys_rich_FGFR| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1111112--------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,21-36,78-104| PSIPRED ccHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHcccHHccccHHHHHHHHccccHHHHHHHHcc //