[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39468.1
DDBJ      :             ribulose 1,5-bisphosphate carboxylase large subunit
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  89/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.14d.58.9
:367 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->344 2oemA PDBj 5e-20 26.9 %
:RPS:PDB   1->343 2d69E PDBj 3e-41 22.6 %
:RPS:SCOP  3->110 1telA2  d.58.9.1 * 6e-05 17.9 %
:RPS:SCOP  112->342 1telA1  c.1.14.1 * 5e-26 23.4 %
:HMM:SCOP  3->112 1wddA2 d.58.9.1 * 5.2e-20 30.0 %
:HMM:SCOP  111->345 2d69A1 c.1.14.1 * 1.2e-61 37.4 %
:HMM:PFM   125->251 PF00016 * RuBisCO_large 5.6e-11 25.2 127/309  
:HMM:PFM   305->347 PF00016 * RuBisCO_large 5.5e-07 41.9 43/309  
:BLT:SWISS 4->367 RBLL1_RHOPA e-113 66.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39468.1 GT:GENE ABE39468.1 GT:PRODUCT ribulose 1,5-bisphosphate carboxylase large subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2497073..2498176 GB:FROM 2497073 GB:TO 2498176 GB:DIRECTION + GB:PRODUCT ribulose 1,5-bisphosphate carboxylase large subunit GB:PROTEIN_ID ABE39468.1 GB:DB_XREF GI:91683166 LENGTH 367 SQ:AASEQ MTDDRFIATYQVTSEPARIAERAQALAIEQSVECPLEAIGDPWVRDAVLGRVAGIDEIAEGRYAVRIALASATAPAEPGQLINMLFGNASIQPDVALTDVELPPLYLKAFGGPKLGSDGIRALAGAHGRALTASALKPQGLSPQALAAIAGRLAAGGVDLIKDDHGLADQAYSPFAARIAAVWRAVRNSNDSSGRRTLYAPHVSGSLDDMRRQLDGIRAEGIPALMMMPMIVGLSNFHALAKEAEGLVVLAHPALSGATRIAPPLLLGRLFRLFGADATVFPHHGGRFASTPQTCRALADAARGAWGGLKPCLPAPAGGIAIDRVAELLSFYGEDVMLLIGGSLLAAREQLSEQAARFAAEVAAHGR GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 4->367|RBLL1_RHOPA|e-113|66.8|364/368| SEG 145->157|alaaiagrlaagg| SEG 176->187|aariaavwravr| SEG 262->276|applllgrlfrlfga| SEG 355->364|aarfaaevaa| BL:PDB:NREP 1 BL:PDB:REP 7->344|2oemA|5e-20|26.9|335/407| RP:PDB:NREP 1 RP:PDB:REP 1->343|2d69E|3e-41|22.6|337/410| HM:PFM:NREP 2 HM:PFM:REP 125->251|PF00016|5.6e-11|25.2|127/309|RuBisCO_large| HM:PFM:REP 305->347|PF00016|5.5e-07|41.9|43/309|RuBisCO_large| RP:SCP:NREP 2 RP:SCP:REP 3->110|1telA2|6e-05|17.9|106/141|d.58.9.1| RP:SCP:REP 112->342|1telA1|5e-26|23.4|231/283|c.1.14.1| HM:SCP:REP 3->112|1wddA2|5.2e-20|30.0|110/0|d.58.9.1|1/1|RuBisCO, large subunit, small (N-terminal) domain| HM:SCP:REP 111->345|2d69A1|1.2e-61|37.4|235/0|c.1.14.1|1/1|RuBisCo, C-terminal domain| OP:NHOMO 140 OP:NHOMOORG 115 OP:PATTERN --1-11----------1------2---1---1---11------111-11-111-1111---------- ----------------------------------------------------1------------------------------------------------------1-1---------------11111111111---------1--1-111--------------------------------------1111111111111111111-1111111111--11------11---------------------------------------------------------------------------------------------------------------------------------------------------------1------22233----------2---1--2---1--1---1111111111----1----------------1------1------------------------------------1---1------------1---------1--------------1-2----------------------------------------------------------------------------------11----------------------------------11----------------------------------------------------------------------------------------------------------1---------------------------------------1-----------------------------------------------------------------------------------------------1------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2B221---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 345 STR:RPRED 94.0 SQ:SECSTR TTETcEEEEEEEEEccccHHHHHHHHHHHTTTccccccccccTTcGGGccEEEEEEEETTEEEEEEEEEEEEGGGccTTcHHHHHGGcTTEEEEEEEEEEEccHHHHTTccccccHHHHHHHHHTcccccEEEEccccccccHHHHHHHHHHHHHHTccEEEccTTccccTTccHHHHHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHTTccEEEEEHHHHcHHHHHHHHHHHHTcEEEEEcTTTHHHHccTTcEEcHHHHHHHHcEEEcccccccccccHHHHHHHHHHHHcccTTccccEEEEcccccGGGHHHHHHHHccccEEEcHHHHH###################### DISOP:02AL 366-368| PSIPRED ccccEEEEEEEEccccccHHHHHHHHHcccccccccEEcccHHHHHHHccEEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHccccEEEEccccccHHHcccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccEEEccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHccc //