[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39477.1
DDBJ      :             Phenylacetic acid degradation-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->135 2pimA PDBj 3e-15 40.8 %
:RPS:PDB   14->138 2b6eD PDBj 6e-17 15.7 %
:RPS:SCOP  19->133 1zkiA1  d.38.1.5 * 1e-19 25.7 %
:HMM:SCOP  10->136 1zkiA1 d.38.1.5 * 5.9e-29 36.8 %
:RPS:PFM   52->128 PF03061 * 4HBT 3e-04 37.7 %
:HMM:PFM   53->127 PF03061 * 4HBT 1.3e-12 36.0 75/79  
:HMM:PFM   35->52 PF00514 * Arm 0.00061 55.6 18/41  
:BLT:SWISS 26->141 Y293_THEAC 3e-04 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39477.1 GT:GENE ABE39477.1 GT:PRODUCT Phenylacetic acid degradation-related protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2505599..2506057 GB:FROM 2505599 GB:TO 2506057 GB:DIRECTION + GB:PRODUCT Phenylacetic acid degradation-related protein GB:PROTEIN_ID ABE39477.1 GB:DB_XREF GI:91683175 InterPro:IPR003736 InterPro:IPR006683 LENGTH 152 SQ:AASEQ MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGPALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRRMGTQTAWAAAQKPA GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 26->141|Y293_THEAC|3e-04|29.6|108/132| BL:PDB:NREP 1 BL:PDB:REP 13->135|2pimA|3e-15|40.8|120/127| RP:PDB:NREP 1 RP:PDB:REP 14->138|2b6eD|6e-17|15.7|121/143| RP:PFM:NREP 1 RP:PFM:REP 52->128|PF03061|3e-04|37.7|77/79|4HBT| HM:PFM:NREP 2 HM:PFM:REP 53->127|PF03061|1.3e-12|36.0|75/79|4HBT| HM:PFM:REP 35->52|PF00514|0.00061|55.6|18/41|Arm| RP:SCP:NREP 1 RP:SCP:REP 19->133|1zkiA1|1e-19|25.7|113/126|d.38.1.5| HM:SCP:REP 10->136|1zkiA1|5.9e-29|36.8|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 61 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------1-----------------1--------1-------------------1------------------------------------------------------------------------------------------------1-1---------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------2112-------3-2-----11-1111111111-------1-1--2-------1--------2-1----------------------------------------------------------------1-------------------------21---11---------1---------1-------------------------------------------1-----------------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------------------1--1---1-1111-------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 95.4 SQ:SECSTR #######HHHHHHHHTTTcHHHHTTcEEEEEccccTEccEEEEEccTTTcTTccccHHHHHHHHHHHHHHHHHTTccTTEEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEETTccEEEEEEEEEEEEEcTcccccccccccc DISOP:02AL 1-1,141-153| PSIPRED ccHHHHHHHHHcccccccHHHHHccEEEEEEEccccEEEEEEEEcHHHcccccEEEHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEEEcccccccccccccc //