[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39481.1
DDBJ      :             glutathione S-transferase-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  375/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->196 3gx0A PDBj 7e-64 55.6 %
:RPS:PDB   2->194 3einA PDBj 3e-40 25.7 %
:RPS:SCOP  1->112 1z3eA1  c.47.1.12 * 2e-12 15.5 %
:RPS:SCOP  94->212 1jlvA1  a.45.1.1 * 4e-21 25.9 %
:HMM:SCOP  1->89 1k0dD2 c.47.1.5 * 2.4e-21 44.7 %
:HMM:SCOP  78->216 1nhyA1 a.45.1.1 * 8.6e-37 42.2 %
:RPS:PFM   14->80 PF02798 * GST_N 7e-10 50.0 %
:RPS:PFM   129->195 PF00043 * GST_C 8e-06 38.8 %
:HMM:PFM   5->81 PF02798 * GST_N 1.1e-12 33.8 68/75  
:HMM:PFM   134->196 PF00043 * GST_C 1.3e-12 27.0 63/95  
:BLT:SWISS 1->196 YFCG_ECOLI 2e-63 55.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39481.1 GT:GENE ABE39481.1 GT:PRODUCT glutathione S-transferase-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2508529..2509242 GB:FROM 2508529 GB:TO 2509242 GB:DIRECTION + GB:PRODUCT glutathione S-transferase-like GB:PROTEIN_ID ABE39481.1 GB:DB_XREF GI:91683179 InterPro:IPR004045 InterPro:IPR004046 LENGTH 237 SQ:AASEQ MIELYYAPTPNGWKISIMLEECGLPYKVAPMQLGRGDQHKPDYLKLSPNGRMPAIVDHAPQDGGGPLSIFESGAILIYLAEKSGRFMPAAARPRSEVTQWLMWQMAGLGPMLGQNGHFLLYAPEKIPYAIERYTREAKRLYGVLDARLADRDYIAGDYSIADMACFPWIMTHKAQGLTLDDYPNVKRWYALLRARPKLQAGLALGKEDRKPMDEQARKLLFGVDAPAHADAQGSQQQ GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 1->196|YFCG_ECOLI|2e-63|55.6|196/215| BL:PDB:NREP 1 BL:PDB:REP 1->196|3gx0A|7e-64|55.6|196/204| RP:PDB:NREP 1 RP:PDB:REP 2->194|3einA|3e-40|25.7|183/207| RP:PFM:NREP 2 RP:PFM:REP 14->80|PF02798|7e-10|50.0|60/71|GST_N| RP:PFM:REP 129->195|PF00043|8e-06|38.8|67/98|GST_C| HM:PFM:NREP 2 HM:PFM:REP 5->81|PF02798|1.1e-12|33.8|68/75|GST_N| HM:PFM:REP 134->196|PF00043|1.3e-12|27.0|63/95|GST_C| RP:SCP:NREP 2 RP:SCP:REP 1->112|1z3eA1|2e-12|15.5|110/114|c.47.1.12| RP:SCP:REP 94->212|1jlvA1|4e-21|25.9|116/123|a.45.1.1| HM:SCP:REP 1->89|1k0dD2|2.4e-21|44.7|85/102|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 78->216|1nhyA1|8.6e-37|42.2|135/144|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 1523 OP:NHOMOORG 497 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------942433-112211-1-111143341---------1-----------------------------------------------------------------------------------------------------1---11111111111111-------------1111111111-----------------------------------------------------8336-----43D9B4446367622222222223-4746585A457-51135439B578383224642122364--------275-1131-----------------------------11265-3332E5556654445555E56446368475774-24422432333B361152----41---------123-2-----------------------111135---------------------------21421324313122222223322213122123---111-------332313-2222222222-2222222222222222223354332322312222322222222433222331-222221222222---2-----111111222111------------43434222214-66865655344452343-----------33111111112115533323222--------221111------------------------------------------------- ----77------112687335758A681222223432212222---365B45852226322241211113112221111114344432-9I281121111313----1-33--1--4--------------------------1-------------2-463-1---A65----113219---226364335112---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 98.7 SQ:SECSTR ccEEEEcTTcHHHHHHHHHHHHTcccEEEEccGGGTGGGcHHHHTTcTTccccEEEETTccTccTTEEEEcHHHHHHHHHHHccTTccccHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHTTTcccccccccHHHHHHHHHHHHHHHTTccGGGcHHHHHHHHHHHHcHHHHHHTTcTcccccGGGcccccccTTHHHHccTTTTcc### DISOP:02AL 222-238| PSIPRED cEEEEEccccHHHHHHHHHHHcccccEEEEccccccccccHHHHHccccccccEEEEcccccccccEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHccccHHHccccccccc //