[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39494.1
DDBJ      :             ribosomal RNA methyltransferase RrmJ/FtsJ
Swiss-Prot:RRMJ_RHOPS   RecName: Full=Ribosomal RNA large subunit methyltransferase J;         EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase;

Homologs  Archaea  35/68 : Bacteria  448/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->221 1eizA PDBj 5e-34 46.0 %
:RPS:PDB   43->223 1eizA PDBj 3e-18 44.4 %
:RPS:SCOP  43->223 1eizA  c.66.1.2 * 3e-59 45.5 %
:HMM:SCOP  43->224 1ej0A_ c.66.1.2 * 5.3e-42 40.8 %
:RPS:PFM   46->220 PF01728 * FtsJ 2e-26 41.3 %
:HMM:PFM   44->222 PF01728 * FtsJ 1.6e-58 46.6 176/181  
:BLT:SWISS 1->235 RRMJ_RHOPS e-132 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39494.1 GT:GENE ABE39494.1 GT:PRODUCT ribosomal RNA methyltransferase RrmJ/FtsJ GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2523819..2524526 GB:FROM 2523819 GB:TO 2524526 GB:DIRECTION + GB:PRODUCT ribosomal RNA methyltransferase RrmJ/FtsJ GB:PROTEIN_ID ABE39494.1 GB:DB_XREF GI:91683192 InterPro:IPR002877 LENGTH 235 SQ:AASEQ MAKDTTGRMRVTVKSAGRMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLLEIDDKYHFLKSGLAVADLGAAPGGWSQIAAKRVGAPDGRGKVIAIDLLEMGEIPGVTFAQLDFLDDAAPDRLREMLGGGADVVMSDMAANTTGHRKTDQLRIVGLVESAAQFASEVLKPGGTFVAKVFQSGADATLMTQLKRDFATVKHVKPAASRKDSSERYVLAMGFRGVPIVAPETVDE GT:EXON 1|1-235:0| SW:ID RRMJ_RHOPS SW:DE RecName: Full=Ribosomal RNA large subunit methyltransferase J; EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase; SW:GN Name=rrmJ; Synonyms=ftsJ; OrderedLocusNames=RPD_2259; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|RRMJ_RHOPS|e-132|100.0|235/235| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 43->221|1eizA|5e-34|46.0|176/180| RP:PDB:NREP 1 RP:PDB:REP 43->223|1eizA|3e-18|44.4|178/180| RP:PFM:NREP 1 RP:PFM:REP 46->220|PF01728|2e-26|41.3|172/179|FtsJ| HM:PFM:NREP 1 HM:PFM:REP 44->222|PF01728|1.6e-58|46.6|176/181|FtsJ| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 1 RP:SCP:REP 43->223|1eizA|3e-59|45.5|178/181|c.66.1.2| HM:SCP:REP 43->224|1ej0A_|5.3e-42|40.8|179/0|c.66.1.2|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1099 OP:NHOMOORG 679 OP:PATTERN -----------------------111111111111111111111111111111--------111--11 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111-11111111111111111111111111-1111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------111111-1-------------------------111111111111111111111111111111111-11111111--111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------111-11-111--------------------------------------- 2212332-83422333323323323323323333221433244221223232313233333333333333333333333333333333-2323222323332333223435353341222322354252AM5-4561222423712222432231513324235332433A36342323I2323332322352354444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 94.0 SQ:SECSTR ############ccccccHHHHccTTcHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHccccTTcEEEEEccTTcHHHHHHHHHHccccTTcEEEEEEcccccccTTEEEEEccTTcHHHHHHHHHHTTccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccTTHHHHHHHHHHHEEEEEEEccTTccTTccEEEEEEEEEcccEEcccEEE## DISOP:02AL 1-29,229-230,235-236| PSIPRED cccccccEEEEEEEEccccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEcccHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHccEEEEEcccccccccEEEEEEEEcccccccccHHHccc //