[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39504.1
DDBJ      :             GMP synthase (glutamine-hydrolyzing)
Swiss-Prot:GUAA_RHOP2   RecName: Full=GMP synthase [glutamine-hydrolyzing];         EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase;

Homologs  Archaea  64/68 : Bacteria  850/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.26.2d.52.2
:556 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->556 1gpmA PDBj e-153 55.6 %
:RPS:PDB   45->153 1aa7A PDBj 1e-19 7.3 %
:RPS:PDB   134->556 3dlaB PDBj 7e-61 12.9 %
:RPS:SCOP  45->237 1gpmA2  c.23.16.1 * 9e-44 49.7 %
:RPS:SCOP  239->435 1gpmA1  c.26.2.1 * 1e-36 60.0 %
:RPS:SCOP  436->556 1gpmA3  d.52.2.1 * 4e-27 57.9 %
:HMM:SCOP  38->268 1l9xA_ c.23.16.1 * 1.9e-58 35.4 %
:HMM:SCOP  228->449 1jgtA1 c.26.2.1 * 1e-61 44.6 %
:HMM:SCOP  436->556 1gpmA3 d.52.2.1 * 1.6e-49 68.6 %
:RPS:PFM   48->228 PF00117 * GATase 3e-19 33.1 %
:RPS:PFM   261->433 PF02540 * NAD_synthase 1e-12 36.2 %
:RPS:PFM   466->555 PF00958 * GMP_synt_C 1e-32 68.9 %
:HMM:PFM   464->555 PF00958 * GMP_synt_C 4.1e-42 64.1 92/93  
:HMM:PFM   47->231 PF00117 * GATase 1.1e-38 32.0 181/192  
:HMM:PFM   251->285 PF02540 * NAD_synthase 6e-09 42.9 35/242  
:BLT:SWISS 42->556 GUAA_RHOP2 0.0 94.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39504.1 GT:GENE ABE39504.1 GT:PRODUCT GMP synthase (glutamine-hydrolyzing) GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2533666..2535336 GB:FROM 2533666 GB:TO 2535336 GB:DIRECTION + GB:PRODUCT GMP synthase (glutamine-hydrolyzing) GB:PROTEIN_ID ABE39504.1 GB:DB_XREF GI:91683202 InterPro:IPR000991 InterPro:IPR001317 InterPro:IPR001674 InterPro:IPR004479 InterPro:IPR004739 InterPro:IPR006220 InterPro:IPR011702 InterPro:IPR012998 LENGTH 556 SQ:AASEQ MSAAAPVFPVASRAAVAYLLPMTAPSTSSASAADSSPHVAAIHEKILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLEADAPKAPMAILQAGVPVLGICYGEQTMAAQLGGTVEGGHHREFGRATIEITDDCALFDGVWQKGGQYDVWMSHGDRVTKLPEGFRGVAKAAGSPIAVIADDSRKFYAMQFHPEVVHTPDGAKILRNFVRKVAGLTGDWTMRAFREEAVEKIRAQVGQGKVICGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLLRKDEGKSVVDLFRHHYNIPLVHVDAADTFLGALKGVTDPEQKRKIIGKLFIDVFDAEAKVVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITAEKLEILRNADAVYIDQIRKAGLYDVIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGMTADFYAFDMNFLGATATRIINEVKGVNRVVYDITSKPPGTIEWE GT:EXON 1|1-556:0| SW:ID GUAA_RHOP2 SW:DE RecName: Full=GMP synthase [glutamine-hydrolyzing]; EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase; SW:GN Name=guaA; OrderedLocusNames=RPB_3189; SW:KW ATP-binding; Complete proteome; Glutamine amidotransferase;GMP biosynthesis; Ligase; Nucleotide-binding; Purine biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 42->556|GUAA_RHOP2|0.0|94.2|515/540| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0006177|"GO:GMP biosynthetic process"|GMP biosynthesis| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| SEG 23->41|tapstssasaadssphvaa| BL:PDB:NREP 1 BL:PDB:REP 42->556|1gpmA|e-153|55.6|493/501| RP:PDB:NREP 2 RP:PDB:REP 45->153|1aa7A|1e-19|7.3|109/158| RP:PDB:REP 134->556|3dlaB|7e-61|12.9|395/649| RP:PFM:NREP 3 RP:PFM:REP 48->228|PF00117|3e-19|33.1|178/185|GATase| RP:PFM:REP 261->433|PF02540|1e-12|36.2|152/208|NAD_synthase| RP:PFM:REP 466->555|PF00958|1e-32|68.9|90/93|GMP_synt_C| HM:PFM:NREP 3 HM:PFM:REP 464->555|PF00958|4.1e-42|64.1|92/93|GMP_synt_C| HM:PFM:REP 47->231|PF00117|1.1e-38|32.0|181/192|GATase| HM:PFM:REP 251->285|PF02540|6e-09|42.9|35/242|NAD_synthase| GO:PFM:NREP 8 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| GO:PFM GO:0003952|"GO:NAD+ synthase (glutamine-hydrolyzing) activity"|PF02540|IPR003694| GO:PFM GO:0005524|"GO:ATP binding"|PF02540|IPR003694| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02540|IPR003694| GO:PFM GO:0003922|"GO:GMP synthase (glutamine-hydrolyzing) activity"|PF00958|IPR001674| GO:PFM GO:0005524|"GO:ATP binding"|PF00958|IPR001674| GO:PFM GO:0006164|"GO:purine nucleotide biosynthetic process"|PF00958|IPR001674| GO:PFM GO:0006177|"GO:GMP biosynthetic process"|PF00958|IPR001674| RP:SCP:NREP 3 RP:SCP:REP 45->237|1gpmA2|9e-44|49.7|193/205|c.23.16.1| RP:SCP:REP 239->435|1gpmA1|1e-36|60.0|175/175|c.26.2.1| RP:SCP:REP 436->556|1gpmA3|4e-27|57.9|121/121|d.52.2.1| HM:SCP:REP 38->268|1l9xA_|1.9e-58|35.4|229/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| HM:SCP:REP 228->449|1jgtA1|1e-61|44.6|222/299|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 436->556|1gpmA3|1.6e-49|68.6|121/0|d.52.2.1|1/1|GMP synthetase C-terminal dimerisation domain| OP:NHOMO 1531 OP:NHOMOORG 1104 OP:PATTERN 1112--2222222223-211111322233213323222333332212323333233223222221-22 2111121222211121111-1111111111111111111111111111112211111111111111111111111111112221111122221211---111111111111-------111111-112222222211111111112112111111111111111111212121111111111121311111112222222332233233121111232111123211111212111111111111111111111111111-1112211111111-13222222111222222222222222222222222222211222111112122111111111121211111212111121111111111111112111122211111111122111112111122222222222-22222222222111121111111111132111111111111111111111111111111111111---------------111111111111111111111211111111111111111111111111221222211231111111111111111111111121321212112221121111122111124221221222222111111111122112112211111112123333213233231232111-11111------22111222222222222-222222222222222222222211221222122222222222212222222111111111111111112111112222111111111111111111111111111111111121111211111111121122222111112111112222211111111111111111111111111111-1-1------1------1------1------1-11111111122 1111111-311-12111111111111111111111111211121111112112111111111111111111111111-1111111111-11111131111111111-1212111111112111112-11251-11211111-1111111-1111111112651111111123322111191111111131221133221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 515 STR:RPRED 92.6 SQ:SECSTR #########################################HcccEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccEEEEccccccGGGTGGGHHHHHHHHHHccccEEEEEEccccHHHHHHcTTcccccccccccEEEEETTEEEEEcccccccccccEEEEEEEEHHHHHHHHHHcHHHHHHHHHTHHHHHccEEEEEccccccccccccccccccTTcccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHHHHHHHTTccGGGEEEEEccccHHHHHHHHHHHTcEEEEccHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHTcTEEEEEcccHHHHHHHTEEEEEcHccHHHHTcccccccTTcccEEccTTccHHHHHHHHHHHHHHcTTHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHcccHHHHHHHHHHHHccTTcccccccccGGGcccccHHHHHHHHHHHHHHTTcHHHHHTcccccccccTTccccTTTTcccccccccHHHHH DISOP:02AL 1-4,25-37,556-557| PSIPRED ccccccccccccHHHHHHHHHcccccccccccccccccHHHHccEEEEEEccccHHHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEcccccccHHccccHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEcccccccccEEEEEccccccccccccccEEEEEEEEccEEcccccccEEEEEcccccEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHcccccccccccccccccccccccHHcccEEEEcHHHHHHHHHHHHHHHccccHHHHcccccccccEEEEEccHHHHHHHHHHHHccHHHHHHHHHccccccHHHccEEEccccEEcccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHccccccEEEEEEcccccccccccc //