[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39513.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   46->190 1cjbA PDBj 3e-05 9.0 %
:RPS:SCOP  78->176 1vchA1  c.61.1.1 * 1e-05 21.3 %
:HMM:SCOP  49->195 1nonA_ c.61.1.1 * 1.1e-09 23.0 %
:HMM:PFM   67->190 PF00156 * Pribosyltran 1.1e-11 19.6 112/125  
:HMM:PFM   12->70 PF07108 * PipA 0.00042 30.5 59/228  
:BLT:SWISS 43->193 COMFC_BACSU 2e-07 26.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39513.1 GT:GENE ABE39513.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2545104..2545697) GB:FROM 2545104 GB:TO 2545697 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39513.1 GB:DB_XREF GI:91683211 LENGTH 197 SQ:AASEQ MAIVKINPIKIEGRWHSGIALDLHTTSSTPIGYNESGHMQFDTVRPEIAELLYRLKNRADKDAAGPIIETVANYLSAHREKFDCIVPVPPSSQRALQPVIVLATGIGAALAVPVLSCITTTRPTSQLKNVTDPAERKKQVEGLYQVDATQTQGRSILLFDDLFRSGTTMNAITDELLGPGKAASVRALTITKTRSNH GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 43->193|COMFC_BACSU|2e-07|26.9|145/100| RP:PDB:NREP 1 RP:PDB:REP 46->190|1cjbA|3e-05|9.0|144/227| HM:PFM:NREP 2 HM:PFM:REP 67->190|PF00156|1.1e-11|19.6|112/125|Pribosyltran| HM:PFM:REP 12->70|PF07108|0.00042|30.5|59/228|PipA| RP:SCP:NREP 1 RP:SCP:REP 78->176|1vchA1|1e-05|21.3|89/168|c.61.1.1| HM:SCP:REP 49->195|1nonA_|1.1e-09|23.0|139/179|c.61.1.1|1/1|PRTase-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------1--------------111--------------------------------------------------------------------------------1------------------------------1-----------------------------------1---------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 73.1 SQ:SECSTR #############################################ccGGGccccTTTGGGEEEEEEcHHHHHHHHHHHHHHHHHHTTccEEEEEEETTTHHHHHHHHHHHHHHHHHHccTTccccEEEEEEEEETEEEEEEEEEEccGGGGcTcEEEEEEEEEcccHHHHHHHHHHGGGc#ccEEEEEEE####### DISOP:02AL 1-1,124-140,196-198| PSIPRED ccEEEEEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHccccHHHEEEEccccHHcccccHHHHHHHHHcHHccccccccccEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEEEccccc //