[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39539.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  440/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->126 1q06B PDBj 2e-24 41.6 %
:RPS:PDB   1->120 3d70A PDBj 9e-22 20.2 %
:RPS:SCOP  1->126 1q05A  a.6.1.3 * 7e-20 33.1 %
:HMM:SCOP  1->126 1q06A_ a.6.1.3 * 1.1e-34 42.9 %
:RPS:PFM   3->38 PF00376 * MerR 5e-05 44.4 %
:RPS:PFM   43->104 PF09278 * MerR-DNA-bind 3e-08 46.8 %
:HMM:PFM   43->107 PF09278 * MerR-DNA-bind 4.4e-24 49.2 65/65  
:HMM:PFM   2->38 PF00376 * MerR 8.7e-17 43.2 37/38  
:BLT:SWISS 1->126 HMMR_RHILV 5e-46 65.1 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39539.1 GT:GENE ABE39539.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2574611..2575009) GB:FROM 2574611 GB:TO 2575009 GB:DIRECTION - GB:PRODUCT transcriptional regulator GB:PROTEIN_ID ABE39539.1 GB:DB_XREF GI:91683237 InterPro:IPR000551 InterPro:IPR011789 LENGTH 132 SQ:AASEQ MNIGAASEKSGLPAKTIRYYEDIGLLTADRASNGYRDYSIADVHRMRFIQRSRHLGFSVEECRQLLSLYHDKERESADVKALAEAKLAEIDRKLVELAELRDTLRHLVRNCHGDSRPDCPILDGLSRSDHTQ GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|HMMR_RHILV|5e-46|65.1|126/129| COIL:NAA 17 COIL:NSEG 1 COIL:REGION 78->94| BL:PDB:NREP 1 BL:PDB:REP 1->126|1q06B|2e-24|41.6|125/126| RP:PDB:NREP 1 RP:PDB:REP 1->120|3d70A|9e-22|20.2|114/276| RP:PFM:NREP 2 RP:PFM:REP 3->38|PF00376|5e-05|44.4|36/37|MerR| RP:PFM:REP 43->104|PF09278|3e-08|46.8|62/65|MerR-DNA-bind| HM:PFM:NREP 2 HM:PFM:REP 43->107|PF09278|4.4e-24|49.2|65/65|MerR-DNA-bind| HM:PFM:REP 2->38|PF00376|8.7e-17|43.2|37/38|MerR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 1->126|1q05A|7e-20|33.1|121/122|a.6.1.3| HM:SCP:REP 1->126|1q06A_|1.1e-34|42.9|126/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 1074 OP:NHOMOORG 441 OP:PATTERN -------------------------------------------------------------------- 11-1------12-1-1111-1----111111--11123-4-22311-2----124-1---235--211-11---------12-------------------1----------------------------------1-1-----2-311211111-1------111-121-------------211------2111111111-1121111---1-111-1-2---22222222----------------1------------------11111-1----2------1--1--11-----1-------------1-----------1------------1----------------------------------2--3115----------2151-2--33423344436-23215352523-2333326322241424651332332431111111131-11132------------------------------431912233445675542222882144443367B3339--784-5286726241435211-21-------15--12---------1-----------312-----1---------------------------243328A4253133222335262292222823---2--3------23222322222222222-2222222222222222222223222243332343333344223322211121-222222222222---4-----1111-3321111213-32232-212232511-1-2423552223334365422----------2223111112321153--1-------------33--------------------------------------------------14- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR EEHHHHHHHHTccHHHHHHHHHTTcccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHH# DISOP:02AL 125-125,127-133| PSIPRED ccHHHHHHHHcccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccc //