[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39570.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39570.1 GT:GENE ABE39570.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2610357..2610695 GB:FROM 2610357 GB:TO 2610695 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39570.1 GB:DB_XREF GI:91683268 LENGTH 112 SQ:AASEQ MRASSPRMTILVSNSFKQPRLHALAAHRARVLPGEPPRNEGRRRAAKRGVGSLAIRSSPARGRRSRTARRLAARHLGDFGCQVRSSGSRELSGISPASAAPVQPTSSGSRSQ GT:EXON 1|1-112:0| SEG 20->30|rlhalaahrar| SEG 33->44|pgepprnegrrr| SEG 54->74|airsspargrrsrtarrlaar| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,33-49,56-70,88-113| PSIPRED ccccccEEEEEEcccccccHHHHHHHHHHHccccccccHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccccc //