[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39588.1
DDBJ      :             heme utilization protein HuvX
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.62.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->166 2ph0B PDBj 2e-34 48.3 %
:RPS:SCOP  15->169 2hqvA1  e.62.1.2 * 3e-40 40.4 %
:HMM:SCOP  1->170 2hqvA1 e.62.1.2 * 4.5e-49 36.5 %
:RPS:PFM   28->165 PF06228 * DUF1008 5e-39 51.4 %
:HMM:PFM   28->166 PF06228 * DUF1008 8.5e-55 48.9 139/141  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39588.1 GT:GENE ABE39588.1 GT:PRODUCT heme utilization protein HuvX GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2631716..2632243 GB:FROM 2631716 GB:TO 2632243 GB:DIRECTION + GB:PRODUCT heme utilization protein HuvX GB:PROTEIN_ID ABE39588.1 GB:DB_XREF GI:91683286 InterPro:IPR010413 LENGTH 175 SQ:AASEQ MVTSEVKLKPADLRAQMAENPAAVIEDVARQWSVSPLDVIEALPPGMVRLGPGDAFVPAMNDIATWGEVTLIVHTEDAIFEFTGEVPAGEIGRGYFNLIQPKGLHGHLKHDNCAAVAFVERPFMGKASAFVAFLNSNGGIMFKVFVGRDSNRQLRADQMVRFNSLARRFSGEPVD GT:EXON 1|1-175:0| BL:PDB:NREP 1 BL:PDB:REP 13->166|2ph0B|2e-34|48.3|151/158| RP:PFM:NREP 1 RP:PFM:REP 28->165|PF06228|5e-39|51.4|138/140|DUF1008| HM:PFM:NREP 1 HM:PFM:REP 28->166|PF06228|8.5e-55|48.9|139/141|DUF1008| RP:SCP:NREP 1 RP:SCP:REP 15->169|2hqvA1|3e-40|40.4|151/172|e.62.1.2| HM:SCP:REP 1->170|2hqvA1|4.5e-49|36.5|170/0|e.62.1.2|1/1|Heme iron utilization protein-like| OP:NHOMO 83 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111-------------------------111-------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1------------------------11----------11111-11--1-1111-1-----1-------1---1---111-111---1---111-1-111---------11----------------------1------111111111111------------------111---1----1111---------------------------------------11111111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 89.7 SQ:SECSTR ############HHHHHHTcccccHHHHHHHTTccHHHHHHTccTTTEEEEEGGGHHHHHHHHTTccEEEEEEEccccEEEEEEEcccEEEETTEEEEcccccccEEEETTTccEEEEEEEEETEEEEEEEEEEcTTccEEEEEEccccTTccccHHHHHHHHHHHHHH###### DISOP:02AL 1-8,170-176| PSIPRED cccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHcccccEEEEcHHHHHHHHHHHcccccEEEEEEcccEEEEEEccccccccccEEEEEccccccccEEEHHHEEEEEEEEccccccEEEEEEEEEccccEEEEEEEccccHHHccHHHHHHHHHHHHHHcccccc //