[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39591.1
DDBJ      :             TonB-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.212.1
:278 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  203->270 1ihrA  d.212.1.2 * 1e-10 16.2 %
:HMM:SCOP  149->274 1lr0A_ d.212.1.1 * 7.6e-21 37.5 %
:RPS:PFM   200->250 PF03544 * TonB 8e-06 45.1 %
:HMM:PFM   199->274 PF03544 * TonB 3.5e-19 32.0 75/79  
:BLT:SWISS 184->251 TONB_HAEIN 3e-09 35.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39591.1 GT:GENE ABE39591.1 GT:PRODUCT TonB-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2633477..2634313 GB:FROM 2633477 GB:TO 2634313 GB:DIRECTION + GB:PRODUCT TonB-like GB:PROTEIN_ID ABE39591.1 GB:DB_XREF GI:91683289 InterPro:IPR003538 InterPro:IPR006260 LENGTH 278 SQ:AASEQ MNAWSLHGRFERGAASRWLLSAAVIVGVHAAAIAAALAYYAQTSPPGETMPTIMIDMAPATAAPEPSRFDLPSGPEMQEAEAPDAEPEPRQRAAAPPEIAATPLQPAPQAPMPPESKSNSDADKAEPTQAKAEPVRAKPIKRQVAKLHPSDTPPAPRSSAPQRAERRAMTTTAALAGADAAAALPTYRQRVAAHLQRFKRYPANARAAGEQGTATLAFTVGRSGQLLGARLVRSSGDARLDAETLSMVRRSELLPPFPPELPQATLSFSVPVNYFVRQ GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 184->251|TONB_HAEIN|3e-09|35.3|68/270| TM:NTM 1 TM:REGION 17->39| SEG 22->41|aavivgvhaaaiaaalayya| SEG 75->114|pemqeaeapdaepeprqraaappeiaatplqpapqapmpp| SEG 153->183|ppaprssapqraerramtttaalagadaaaa| SEG 252->262|ellppfppelp| RP:PFM:NREP 1 RP:PFM:REP 200->250|PF03544|8e-06|45.1|51/79|TonB| HM:PFM:NREP 1 HM:PFM:REP 199->274|PF03544|3.5e-19|32.0|75/79|TonB| GO:PFM:NREP 3 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF03544|IPR003538| GO:PFM GO:0006826|"GO:iron ion transport"|PF03544|IPR003538| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03544|IPR003538| RP:SCP:NREP 1 RP:SCP:REP 203->270|1ihrA|1e-10|16.2|68/73|d.212.1.2| HM:SCP:REP 149->274|1lr0A_|7.6e-21|37.5|112/126|d.212.1.1|1/1|TolA/TonB C-terminal domain| OP:NHOMO 62 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21---3123222---------------------11-------------1--------------22222222---1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------111111111111-------------------------------------------11-----111-------1-------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4,6-7,65-97,105-168,201-209,278-279| PSIPRED cccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccHHHHccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHccHHHHHHcccccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEEcc //