[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39592.1
DDBJ      :             regulatory proteins, IclR
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  295/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:263 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   88->233 1ysqA PDBj 7e-10 32.6 %
:RPS:PDB   11->55 3dp7B PDBj 4e-06 20.0 %
:RPS:PDB   26->78 2b0lA PDBj 6e-04 13.2 %
:RPS:PDB   86->224 3d3oB PDBj 6e-20 13.4 %
:RPS:SCOP  11->75 1mkmA1  a.4.5.33 * 1e-08 17.2 %
:RPS:SCOP  87->228 1td5A  d.110.2.2 * 5e-22 25.4 %
:HMM:SCOP  8->82 1mkmA1 a.4.5.33 * 1.1e-10 36.5 %
:HMM:SCOP  84->251 1mkmA2 d.110.2.2 * 4.5e-31 32.1 %
:RPS:PFM   11->62 PF09339 * HTH_IclR 9e-05 45.1 %
:RPS:PFM   133->228 PF01614 * IclR 2e-08 37.6 %
:HMM:PFM   130->247 PF01614 * IclR 8.5e-21 33.9 118/129  
:HMM:PFM   11->57 PF09339 * HTH_IclR 1.2e-12 34.0 47/52  
:BLT:SWISS 11->233 YIAJ_ECOLI 6e-17 29.9 %
:PROS 246->255|PS00599|AA_TRANSFER_CLASS_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39592.1 GT:GENE ABE39592.1 GT:PRODUCT regulatory proteins, IclR GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2634347..2635138) GB:FROM 2634347 GB:TO 2635138 GB:DIRECTION - GB:PRODUCT regulatory proteins, IclR GB:PROTEIN_ID ABE39592.1 GB:DB_XREF GI:91683290 InterPro:IPR001917 InterPro:IPR005471 LENGTH 263 SQ:AASEQ MSTDEASPGPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGERLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNAAATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRLPNGAVLHSVGMTGPLERIMNKQLSTRLAALRATAATLAKALALGSTIKQRSSS GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 11->233|YIAJ_ECOLI|6e-17|29.9|221/282| PROS 246->255|PS00599|AA_TRANSFER_CLASS_2|PDOC00518| TM:NTM 1 TM:REGION 14->36| SEG 235->253|trlaalrataatlakalal| BL:PDB:NREP 1 BL:PDB:REP 88->233|1ysqA|7e-10|32.6|144/181| RP:PDB:NREP 3 RP:PDB:REP 11->55|3dp7B|4e-06|20.0|45/350| RP:PDB:REP 26->78|2b0lA|6e-04|13.2|53/98| RP:PDB:REP 86->224|3d3oB|6e-20|13.4|134/163| RP:PFM:NREP 2 RP:PFM:REP 11->62|PF09339|9e-05|45.1|51/52|HTH_IclR| RP:PFM:REP 133->228|PF01614|2e-08|37.6|93/127|IclR| HM:PFM:NREP 2 HM:PFM:REP 130->247|PF01614|8.5e-21|33.9|118/129|IclR| HM:PFM:REP 11->57|PF09339|1.2e-12|34.0|47/52|HTH_IclR| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF09339|IPR005471| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF09339|IPR005471| RP:SCP:NREP 2 RP:SCP:REP 11->75|1mkmA1|1e-08|17.2|64/75|a.4.5.33| RP:SCP:REP 87->228|1td5A|5e-22|25.4|142/179|d.110.2.2| HM:SCP:REP 8->82|1mkmA1|1.1e-10|36.5|74/0|a.4.5.33|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->251|1mkmA2|4.5e-31|32.1|168/0|d.110.2.2|1/1|GAF domain-like| OP:NHOMO 657 OP:NHOMOORG 298 OP:PATTERN ------------------------5-----22------------------------------------ --3-1-1211111-22122-24--1C2222215444-5GE-1-1342----1A59411--224183A57521111233----3----1-----1------------------------------------------111------1-------------------------------------1---1---31-------1-11----13222---1-12323--------21----------------------1-------------------------------------------------------------------12--------------------------1-----1-11-1224-1-2---------------2-2-1--73111-22222222212-11---2--43--4332125333334----237--12233111111112---------------------------------------1---9953111221-----4447------5-A88C4--11--111-5---741------------------111-1-------------1211123-1-----------1-------------------------------1-------------------------1--------2-142--1--1111111--111111111-1111111223212-1-1-1111111111111-311-111---211111111111----------------12111--1-----1--1--------112-11111312-1121-1111--------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 87.5 SQ:SECSTR ####ccTHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEEETTEEEEEEEEcccEEEEcTTHHHHHHHHHHHHHHHccEEEEEEEETTEEEEEEEEcccccccccccccccEEGGcHHHHHTTcHHHHHHHHHHHHHHHHHHHHGGGTcccccHHHHHHHHHHHcEEEEEccccTTEEEEEEEccccTTccEEEEEEEHHHHHHcHHHHH############################# DISOP:02AL 1-6,8-10,259-264| PSIPRED cccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEEccccEEEEEccccEEcccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccEEEccccccccEEEEEEEEcccccEEEEEEEEEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //