[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39593.1
DDBJ      :             Extracellular ligand-binding receptor
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  354/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:383 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->353 3hutA PDBj 4e-15 23.2 %
:RPS:PDB   32->372 3eafA PDBj 3e-30 15.7 %
:RPS:SCOP  31->357 1usgA  c.93.1.1 * 1e-50 20.8 %
:HMM:SCOP  30->374 1usgA_ c.93.1.1 * 3.4e-75 35.3 %
:RPS:PFM   52->365 PF01094 * ANF_receptor 2e-29 34.0 %
:HMM:PFM   52->331 PF01094 * ANF_receptor 1.1e-21 21.7 272/348  
:HMM:PFM   3->52 PF05757 * PsbQ 0.0008 22.0 50/203  
:BLT:SWISS 32->360 LIVB7_BRUAB 1e-21 28.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39593.1 GT:GENE ABE39593.1 GT:PRODUCT Extracellular ligand-binding receptor GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2635313..2636464 GB:FROM 2635313 GB:TO 2636464 GB:DIRECTION + GB:PRODUCT Extracellular ligand-binding receptor GB:PROTEIN_ID ABE39593.1 GB:DB_XREF GI:91683291 InterPro:IPR001828 LENGTH 383 SQ:AASEQ MGITRKEFLSSMVAATVLSFVGAANAQQTGPILIGATVPITGPLSLTGKQYQNSLAMAEEDINKAGGINGRQIKVVFEDTQASNGTAVNAFVKLAQETKPAFFFLSSYSTQNLAVAPELKKIGVPAMYAGGADAVADGGNEWMFRIRPADSVSAAGMVRAAVDVIKAKKPGILYIQNDFGQGGAQTAAKRFEAAGIPVVGMEAYGQNDKDFSAQLLSLRSKGADTILIFNYPQDGALVLRQAKLLGFKMPLVTSSAALVPAAMQLLSPADLEGVWGVVDTFMDATAGDRMKDYVERFKAKFGIDPDPYGLAYYDGAFLMADGMRKVGTDPKALREWLAAVKDWQGVGHVYSYDAKGNGVRDLAVVKAKAGSKTLELVQRVNLD GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 32->360|LIVB7_BRUAB|1e-21|28.1|327/399| SEG 129->139|aggadavadgg| BL:PDB:NREP 1 BL:PDB:REP 32->353|3hutA|4e-15|23.2|315/341| RP:PDB:NREP 1 RP:PDB:REP 32->372|3eafA|3e-30|15.7|337/379| RP:PFM:NREP 1 RP:PFM:REP 52->365|PF01094|2e-29|34.0|306/319|ANF_receptor| HM:PFM:NREP 2 HM:PFM:REP 52->331|PF01094|1.1e-21|21.7|272/348|ANF_receptor| HM:PFM:REP 3->52|PF05757|0.0008|22.0|50/203|PsbQ| RP:SCP:NREP 1 RP:SCP:REP 31->357|1usgA|1e-50|20.8|322/345|c.93.1.1| HM:SCP:REP 30->374|1usgA_|3.4e-75|35.3|340/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 976 OP:NHOMOORG 367 OP:PATTERN 11--------------2-2-122-2--1---------------1--------------------1--- -------------------------------------1--1--1------------------2---1--1111111111--------------------------1---------------------1-11--3-------11112---3--111-----------1--1-------------3212111-----------------------------3211--------41------------------------11-----11--11---11----1-11---11111111111111-------------1111111111221-41111111-1---11----2----4--63223371-111---2112--------1111-1FFD314A6AC933343431322-11821B27211-5221336532232A---1-1-111--1--------1----4-2-----------------------------------798679BDABA22222BBB7333323BBE5846-35534134369687C225----32----------3541652227249533623332142-23323211C---1-222222----------11----11-----------------------------------------2-2--2-1111111111-1111111111111111111333--11-----------------311111111--11111111-1----------------211-------------------------2-212221-1222221111--------------------------------------------------------1---------------------------313--13111-2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 348 STR:RPRED 90.9 SQ:SECSTR ########################EEEEccEEEEEEEEccccTTHHHHHHHHHHHHHHHHHHHHHccTTccEEEEEEEEcTTcHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHHHHHHHTcEEEEccccGGGTTcTcTTEEcccccHHHHHHHHHHHHHHHHccEEEEEEEcTTcHHHTTHHHHHHHTGGGTEEEEEEEEccTTcHHHHHHHHHHHTTcccEEEEcccHHHHHHHHHHHHHHTcccEEEEcGGGccTTHHHHHcGGGTTcEEEEEccccGGcTTcHHHHHHHHHHTTccGGccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHccccTTccccccccTTccccccEEEEEEcTTcc########### DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHcccccEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHccHHHHcEEEEEEEccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccEEEEEcccccccccEEEEEEEcccEEEEEEEEEccc //