[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39616.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.5
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->30 1p90A  c.55.5.2 * 2e-04 36.7 %
:HMM:SCOP  1->64 1p90A_ c.55.5.2 * 8.4e-10 33.3 %
:HMM:PFM   19->49 PF04785 * Rhabdo_M2 9.2e-05 41.9 31/202  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39616.1 GT:GENE ABE39616.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2663451..2663720 GB:FROM 2663451 GB:TO 2663720 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39616.1 GB:DB_XREF GI:91683314 LENGTH 89 SQ:AASEQ MLIAVASQNFWTVTAHAGKSRRFLVFKVAPCRAPLEVDRLELPKELTIHEFKGEGAHPLDRVSVSAGGIERGTTFCLLRPTPKRRRQVR GT:EXON 1|1-89:0| HM:PFM:NREP 1 HM:PFM:REP 19->49|PF04785|9.2e-05|41.9|31/202|Rhabdo_M2| RP:SCP:NREP 1 RP:SCP:REP 1->30|1p90A|2e-04|36.7|30/123|c.55.5.2| HM:SCP:REP 1->64|1p90A_|8.4e-10|33.3|63/0|c.55.5.2|1/1|Nitrogenase accessory factor-like| OP:NHOMO 12 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12212---------------------------------------------1-------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,83-90| PSIPRED cEEEEEEcccEEEEcccccEEEEEEEEEcccccccccccccccHHHccHHHccccccccccEEEEEEEEcccEEEEEEcccHHHHHHcc //