[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39617.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   117->157 PF05918 * API5 5e-05 36.6 41/556  
:HMM:PFM   8->82 PF04888 * SseC 0.00019 25.3 75/306  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39617.1 GT:GENE ABE39617.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2663804..2664289 GB:FROM 2663804 GB:TO 2664289 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39617.1 GB:DB_XREF GI:91683315 LENGTH 161 SQ:AASEQ MRYVQSCAALALIAATTFGGAAFAQKGTGEATGMAQRAEKPAIISMSGTVKDTKIGPCKLTTGRSAEGAHLIVQSQDKVVNLHLGPSEAVGDVLKAAPVGQQITFEAFRTDRMPPDAYVAKSVKTADQTFTLRGDNLSPSWARGRGGGRGQGMGRGFGGCF GT:EXON 1|1-161:0| SEG 8->24|aalaliaattfggaafa| SEG 143->159|rgrgggrgqgmgrgfgg| HM:PFM:NREP 2 HM:PFM:REP 117->157|PF05918|5e-05|36.6|41/556|API5| HM:PFM:REP 8->82|PF04888|0.00019|25.3|75/306|SseC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,32-35,143-151| PSIPRED ccHHHHHHHHHHHHHHccccHHHHccccccHHHHHHHccccEEEEEccEEEccccccEEEcccccccccEEEEEccccEEEEEEccHHHHHHHHHHcccccEEEEHHHHccccccHHHHHHHHcccccEEEEEcccccccHHccccccccccccccccccc //