[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39629.1
DDBJ      :             antenna complex, alpha/beta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.3.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->45 1ijdA PDBj 7e-09 50.0 %
:RPS:SCOP  2->45 1ijdA  f.3.1.1 * 5e-09 50.0 %
:HMM:SCOP  1->53 1nkzA_ f.3.1.1 * 1.2e-17 58.5 %
:HMM:PFM   3->41 PF00556 * LHC 1.1e-15 41.0 39/40  
:BLT:SWISS 1->57 LHA4_RHOPA 1e-19 73.7 %
:PROS 25->41|PS00968|ANTENNA_COMP_ALPHA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39629.1 GT:GENE ABE39629.1 GT:PRODUCT antenna complex, alpha/beta subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2672936..2673115) GB:FROM 2672936 GB:TO 2673115 GB:DIRECTION - GB:PRODUCT antenna complex, alpha/beta subunit GB:PROTEIN_ID ABE39629.1 GB:DB_XREF GI:91683327 InterPro:IPR000066 InterPro:IPR002361 LENGTH 59 SQ:AASEQ MNQGRIWTVVKPTVGLPLLLGSVAVMVVLVHFAVLTHTTWVAKFMNGKTAAIESSVKLG GT:EXON 1|1-59:0| BL:SWS:NREP 1 BL:SWS:REP 1->57|LHA4_RHOPA|1e-19|73.7|57/59| PROS 25->41|PS00968|ANTENNA_COMP_ALPHA|PDOC00748| TM:NTM 1 TM:REGION 14->36| SEG 23->35|vavmvvlvhfavl| BL:PDB:NREP 1 BL:PDB:REP 2->45|1ijdA|7e-09|50.0|44/45| HM:PFM:NREP 1 HM:PFM:REP 3->41|PF00556|1.1e-15|41.0|39/40|LHC| RP:SCP:NREP 1 RP:SCP:REP 2->45|1ijdA|5e-09|50.0|44/46|f.3.1.1| HM:SCP:REP 1->53|1nkzA_|1.2e-17|58.5|53/53|f.3.1.1|1/1|Light-harvesting complex subunits| OP:NHOMO 18 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---32336------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 78.0 SQ:SECSTR #TTGGGGGTccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHTHc############ DISOP:02AL 1-3| PSIPRED ccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccc //