[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39646.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  97/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:299 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  50->157 1s7bA_ f.39.1.1 * 8.3e-10 30.5 %
:HMM:SCOP  196->299 1s7bA_ f.39.1.1 * 9.7e-10 25.3 %
:HMM:PFM   28->149 PF00892 * EamA 1.1e-14 21.5 121/126  
:HMM:PFM   172->297 PF00892 * EamA 3.1e-21 25.6 125/126  
:HMM:PFM   135->174 PF11177 * DUF2964 9.4e-05 32.5 40/62  
:BLT:SWISS 8->282 YIJE_ECOLI 8e-12 22.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39646.1 GT:GENE ABE39646.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2694869..2695768 GB:FROM 2694869 GB:TO 2695768 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF6, transmembrane GB:PROTEIN_ID ABE39646.1 GB:DB_XREF GI:91683344 InterPro:IPR000620 InterPro:IPR004853 LENGTH 299 SQ:AASEQ MTTFHDAAARGRISPLGLFFLGVASIGWGLNFPIMKNLMTEWPPLSARGLSGIIGALALALIATSRGETLRVPRAMWSRLILVSMLTIGGWVAFMGLALLWLRASDAAVLGISIPLWVALVAWPVLGERVSPVRAIALLIALAGIAVLIGGSGFDASLDKLPGILCALAGAVCVAFGTVLTKHFPLALPPLSLATWQIGLGCIPVAVAGLAFEDPHVAALSAIGWASMIYMTLVQFCVCYVCWFAALERLPAATASIGTLLVPVVGVLASAAMLQEPLGLTEVIALTVTLASVALALRS GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 8->282|YIJE_ECOLI|8e-12|22.6|270/301| TM:NTM 10 TM:REGION 12->34| TM:REGION 48->70| TM:REGION 77->99| TM:REGION 106->128| TM:REGION 133->155| TM:REGION 159->181| TM:REGION 192->213| TM:REGION 221->243| TM:REGION 252->274| TM:REGION 277->298| SEG 49->63|glsgiigalalalia| SEG 135->153|aiallialagiavliggsg| SEG 285->297|altvtlasvalal| HM:PFM:NREP 3 HM:PFM:REP 28->149|PF00892|1.1e-14|21.5|121/126|EamA| HM:PFM:REP 172->297|PF00892|3.1e-21|25.6|125/126|EamA| HM:PFM:REP 135->174|PF11177|9.4e-05|32.5|40/62|DUF2964| HM:SCP:REP 50->157|1s7bA_|8.3e-10|30.5|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 196->299|1s7bA_|9.7e-10|25.3|99/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 106 OP:NHOMOORG 98 OP:PATTERN ----------------------------------------------------------------1--- -------------------------------------------------------------------------------1----1-----------------------------------------------------------111----------------------------------------------------------------11-------1-----------------------------------------------------------------------------------------------------------------------------------------1--------------------------1-111--111221-----------------1----------121---2-1-----12----1-----------------------------------------------------------1121------11---------1-11-1-------11---1-1-11--1-11-----------111-------------------------------------------------------------1-----------------------1-----------------------1111111111-111111111111111111121211--------------------1111-11-----------------------1111--------------------------1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-7| PSIPRED ccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHcc //