[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39655.1
DDBJ      :             Leucyltransferase
Swiss-Prot:LFTR_RHOPS   RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;         EC=2.3.2.6;AltName: Full=L/F-transferase;AltName: Full=Leucyltransferase;AltName: Full=Phenyalanyltransferase;

Homologs  Archaea  0/68 : Bacteria  449/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:224 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->189 2z3nA PDBj 7e-35 42.9 %
:RPS:PDB   7->197 2dptA PDBj 5e-70 39.0 %
:RPS:SCOP  7->199 2cxaA1  d.108.1.6 * 2e-64 39.2 %
:HMM:SCOP  7->214 2cxaA1 d.108.1.6 * 1.9e-73 48.0 %
:RPS:PFM   14->186 PF03588 * Leu_Phe_trans 5e-47 52.6 %
:HMM:PFM   13->186 PF03588 * Leu_Phe_trans 3.7e-67 49.4 172/173  
:BLT:SWISS 1->224 LFTR_RHOPS e-122 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39655.1 GT:GENE ABE39655.1 GT:PRODUCT Leucyltransferase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2703509..2704183) GB:FROM 2703509 GB:TO 2704183 GB:DIRECTION - GB:PRODUCT Leucyltransferase GB:PROTEIN_ID ABE39655.1 GB:DB_XREF GI:91683353 InterPro:IPR004616 LENGTH 224 SQ:AASEQ MASRDSANADITPEVLLRAYACGIFPMAESIDDPTLFWVEPELRGIIPLGGFRVASRLARTVRSDVFTVTVNRDFRGVIDGCASPQPGRDDTWINRRIRELYIGLHGIGHCHSVEVWQDDDLVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLLAGGYELLDTQFVTEHLRSFGAIEVPRQRYRALLDDALHGVADFGALPVDQPVSGAQALEIIAKN GT:EXON 1|1-224:0| SW:ID LFTR_RHOPS SW:DE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase; EC=2.3.2.6;AltName: Full=L/F-transferase;AltName: Full=Leucyltransferase;AltName: Full=Phenyalanyltransferase; SW:GN Name=aat; OrderedLocusNames=RPD_2425; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->224|LFTR_RHOPS|e-122|100.0|224/224| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 150->161|valvhlvarlla| BL:PDB:NREP 1 BL:PDB:REP 10->189|2z3nA|7e-35|42.9|175/230| RP:PDB:NREP 1 RP:PDB:REP 7->197|2dptA|5e-70|39.0|187/232| RP:PFM:NREP 1 RP:PFM:REP 14->186|PF03588|5e-47|52.6|171/172|Leu_Phe_trans| HM:PFM:NREP 1 HM:PFM:REP 13->186|PF03588|3.7e-67|49.4|172/173|Leu_Phe_trans| GO:PFM:NREP 2 GO:PFM GO:0008914|"GO:leucyltransferase activity"|PF03588|IPR004616| GO:PFM GO:0030163|"GO:protein catabolic process"|PF03588|IPR004616| RP:SCP:NREP 1 RP:SCP:REP 7->199|2cxaA1|2e-64|39.2|186/229|d.108.1.6| HM:SCP:REP 7->214|2cxaA1|1.9e-73|48.0|204/0|d.108.1.6|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 453 OP:NHOMOORG 450 OP:PATTERN -------------------------------------------------------------------- ---1-------------------------------------1111--1--------------11------------------1--1-----1-------1111111-111---------------11-1111111111111---1-11111111111-----111111111------------111---------------------------------------------------------------------------------------------------------------------------------------------1--------------------1-------------------------1-1111-----11111111121111111111-1-1-11111111111111111111111111-1111111111111111111111111111------------------------------11111111-1111111111111111111111111111111111111111111111111211111111111111111111111111111111-------1-111111111--1-111111---------11111111111-1111111111111111111111111--11111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111--11-----111111111---------------11111111111111111111111111111---------11111111111111-11111111121111--1-111111--------1-------------------------------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 85.3 SQ:SECSTR ######EEccccHHHHHHHHHTTcEEccccTTccccEEEccccEEEEcGGGccccHHHHHHHHTcccEEEEcccHHHHHHHHTTcTcccccTTccHHHHHHHHHHHHTTcEEEEEEEETTEEEEEEEEEEETTEEEEEEEEEccTTHHHHHHHHHHHHHHHTTccEEEEEcccHHHHHTTcEEEcHHHHHHHHHHHT########################### DISOP:02AL 1-3| PSIPRED ccccccccccccHHHHHHHHHcccccccccccccEEEEEcccccEEEEHHHccccHHHHHHHccccEEEEEEHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEEEEEccEEEEEHHHHHHcHHHHccccEEEccccHHHHHHHHHHHHHccccEEEEcccccHHHHHcccEEccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcc //