[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39664.1
DDBJ      :             protein of unknown function DUF1236
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   169->237 PF06823 * DUF1236 2e-07 42.9 %
:HMM:PFM   168->237 PF06823 * DUF1236 9.9e-24 40.0 65/65  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39664.1 GT:GENE ABE39664.1 GT:PRODUCT protein of unknown function DUF1236 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2712359..2713075) GB:FROM 2712359 GB:TO 2713075 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1236 GB:PROTEIN_ID ABE39664.1 GB:DB_XREF GI:91683362 InterPro:IPR009642 LENGTH 238 SQ:AASEQ MTNRLFVSVATAALIASGVVANAQGTGGATGGSGGASPSAGSSAPAERGSAPQMDRSEGQGSGMNQGSGMKSGQSDDKMAPGGARDQRAQDGTPKGGASSDSGKAGKDDDRNIDRKAGNDRDQMNRNADKDRDPANRNAGNDRDRATTGQAGAGGKLSTEQRTKITNVIKNQRIEPQTNINFSISVGTRVPRDVRFHPLPTEIVTIYPDWRGYEFFLVRDEIIVVNPRTLEIVAVLDA GT:EXON 1|1-238:0| SEG 25->52|gtggatggsggaspsagssapaergsap| SEG 57->75|segqgsgmnqgsgmksgqs| SEG 95->110|kggassdsgkagkddd| RP:PFM:NREP 1 RP:PFM:REP 169->237|PF06823|2e-07|42.9|63/64|DUF1236| HM:PFM:NREP 1 HM:PFM:REP 168->237|PF06823|9.9e-24|40.0|65/65|DUF1236| OP:NHOMO 30 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------13121-1111-1------------11121211---------1-12111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,28-156| PSIPRED cccEEEEEEEHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccEEEEcccEEEEccccEEEEEEEEEcccccccccccEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEccEEEEEcccccEEEEEEcc //