[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39668.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->124 PF07886 * BA14K 4.6e-16 46.7 30/31  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39668.1 GT:GENE ABE39668.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2715527..2715901) GB:FROM 2715527 GB:TO 2715901 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39668.1 GB:DB_XREF GI:91683366 LENGTH 124 SQ:AASEQ MMKSRLQGSGTARKMITRALASGVLLAMYGLGMITTTGLAMTASVTPAHAQRGRGRGRGWGGGDAGAAIGLGIGAAIIGGAIAASAAEDARRRDAVGYCAQRYRSFNPETMTYIGKDGRARSCP GT:EXON 1|1-124:0| SEG 48->97|ahaqrgrgrgrgwgggdagaaiglgigaaiiggaiaasaaedarrrdavg| HM:PFM:NREP 1 HM:PFM:REP 95->124|PF07886|4.6e-16|46.7|30/31|BA14K| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,49-59,121-121,124-125| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccc //