[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39686.1
DDBJ      :             Iron-regulated ABC transporter membrane component SufB
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  614/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
b.80.6
:493 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   320->472 2zu0B PDBj 7e-11 24.2 %
:RPS:PDB   44->332 2dyoA PDBj 2e-59 6.9 %
:RPS:SCOP  48->490 1vh4A  b.80.6.1 * 6e-82 16.4 %
:HMM:SCOP  38->491 1vh4A_ b.80.6.1 * 1.8e-138 44.9 %
:RPS:PFM   226->464 PF01458 * UPF0051 3e-64 52.6 %
:HMM:PFM   228->464 PF01458 * UPF0051 2.9e-61 30.3 228/230  
:HMM:PFM   474->488 PF05760 * IER 0.00091 73.3 15/300  
:BLT:SWISS 1->493 YCF24_PORYE e-178 61.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39686.1 GT:GENE ABE39686.1 GT:PRODUCT Iron-regulated ABC transporter membrane component SufB GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2743386..2744867 GB:FROM 2743386 GB:TO 2744867 GB:DIRECTION + GB:PRODUCT Iron-regulated ABC transporter membrane component SufB GB:PROTEIN_ID ABE39686.1 GB:DB_XREF GI:91683384 InterPro:IPR000825 InterPro:IPR010231 LENGTH 493 SQ:AASEQ MAAVQETVDRVRQIDVDQYRYGFETLIESDKAPKGLSEDIVRFISAKKNEPDWMLQWRLEAYRRWLTMTEPTWARVNYPKIDFQDLYYYSAPKPKKTIGSLDEIDPEILETYKKLGIPLREVEVLEGVVRPEGERRIAVDAVFDSVSVATTFQAELKKAGVIFMPISEAIKQHPELVQKYLGTVVPTTDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIADKGSYVSYLEGCTAPQRDENQLHAAVVELVTHDDAEIKYSTVQNWYPGNSEGKGGIYNFVTKRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKMIHLGNNTTSRIISKGIAAGRSQNTYRGLVTAHRKAKGARNFTACDSLLIGDQCGAHTVPYIEAKNTSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVKDVLQQLPMEFAVEAQKLISISLEGSVG GT:EXON 1|1-493:0| BL:SWS:NREP 1 BL:SWS:REP 1->493|YCF24_PORYE|e-178|61.8|484/487| SEG 118->136|plrevevlegvvrpegerr| SEG 138->149|avdavfdsvsva| BL:PDB:NREP 1 BL:PDB:REP 320->472|2zu0B|7e-11|24.2|153/414| RP:PDB:NREP 1 RP:PDB:REP 44->332|2dyoA|2e-59|6.9|261/269| RP:PFM:NREP 1 RP:PFM:REP 226->464|PF01458|3e-64|52.6|230/230|UPF0051| HM:PFM:NREP 2 HM:PFM:REP 228->464|PF01458|2.9e-61|30.3|228/230|UPF0051| HM:PFM:REP 474->488|PF05760|0.00091|73.3|15/300|IER| GO:PFM:NREP 2 GO:PFM GO:0005515|"GO:protein binding"|PF01458|IPR000825| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01458|IPR000825| RP:SCP:NREP 1 RP:SCP:REP 48->490|1vh4A|6e-82|16.4|396/410|b.80.6.1| HM:SCP:REP 38->491|1vh4A_|1.8e-138|44.9|405/413|b.80.6.1|1/1|Stabilizer of iron transporter SufD| OP:NHOMO 1066 OP:NHOMOORG 701 OP:PATTERN 11312221111111121212122122232223111--1111111-11111111-11111212221-22 --21111111111111111-111111111111111111112122121112222221222222212211111122211111112-----2222222221122222222222111111111111112----------1222221112222222221122221212112222221121111111212222211-2222222222222222222222222222222222222222222222222222222222222221-21122-22222211221222222222222233322222222222222222222222232222222221--22----1------1221----1-1121--------1----2211--221211112222211243222222222222222222212222222222211111111111114311111111111111111111112211-21-----------------------------211111-------------111----111111-----1---------11--22-------2----------222---111---21111111-------1--21222-111----------------------11-----122-2--2-------------------111222-------11-1-111111111111-111111111111111111111121222111111111111111111-1112112111111111111111-22212222212221--------------------------2-----------------1111111111-----------1--22222222221111----112222--------111-----------1------1------111111-111222 -1-----1----------------------------------------------------------------------------------------------------1-----------------------------------------------------------------12111F111113111-22111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 422 STR:RPRED 85.6 SQ:SECSTR ###########################################HHHHHHTcEEEEEEEEcGGGccTTccGGGEEEEEEEccccGcccGGGHHHHHHHHGGGcccccccEEEEEETTEEEcTTccHTTTcEEEEEccHHHHHHHHHGGGcccccccEEEEEEEEEcEEEEEEcccTTcccccccTTHHHHHHHHHHHHHHHHHHcccHHHHTccHHHHHHHHHHHHHTcHHHHHHHHHHHcccccccccEEEEccccccccEEccccccTTc##cccTGGGHHHHccTTTc#####cEEEEETTEEEcTTccHHHHHHHHccTTccEEEEEEEcccccEEEEEEEEcccTTcEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEcTTcTTcEEEEEEEEEEccTTcEEEEEEEEEEcccccEEEEEEEEEcccHHHHHHHHTTTccHHHHHHHHHHHHHHHHHTTc##################### DISOP:02AL 1-6| PSIPRED cccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccHHHccHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEHHcccHHHHcccHHHHHHcccEEccHHHHHHHHHHHHHHHHccEEcccccHHHHHHHHHHcccEEEEEccccEEcccEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEcccccEEEEccEEEEEccccEEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccc //