[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39690.1
DDBJ      :             protein of unknown function DUF59
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  351/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->116 1uwdA PDBj 4e-16 39.3 %
:RPS:PDB   28->119 3cq1A PDBj 3e-21 33.3 %
:RPS:SCOP  21->121 1uwdA  d.52.8.2 * 2e-19 34.7 %
:HMM:SCOP  28->121 1uwdA_ d.52.8.2 * 2.8e-29 48.9 %
:RPS:PFM   28->76 PF01883 * DUF59 2e-11 63.3 %
:HMM:PFM   27->100 PF01883 * DUF59 1.2e-27 44.6 74/76  
:BLT:SWISS 23->121 YITW_BACSU 6e-14 35.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39690.1 GT:GENE ABE39690.1 GT:PRODUCT protein of unknown function DUF59 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2748333..2748701 GB:FROM 2748333 GB:TO 2748701 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF59 GB:PROTEIN_ID ABE39690.1 GB:DB_XREF GI:91683388 InterPro:IPR002744 LENGTH 122 SQ:AASEQ MTDTIEAKANMQTVSALPPEETERLGTEIVSALKTVFDPEIPADIYELGLIYKVEIKDDRTVDVEMTLTTPNCPAAGELPTMVENAVATVPGVGVVNVSIVWEPAWTPERMSDEARLVLNMW GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 23->121|YITW_BACSU|6e-14|35.4|99/102| SEG 85->98|navatvpgvgvvnv| BL:PDB:NREP 1 BL:PDB:REP 28->116|1uwdA|4e-16|39.3|89/102| RP:PDB:NREP 1 RP:PDB:REP 28->119|3cq1A|3e-21|33.3|90/98| RP:PFM:NREP 1 RP:PFM:REP 28->76|PF01883|2e-11|63.3|49/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 27->100|PF01883|1.2e-27|44.6|74/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 21->121|1uwdA|2e-19|34.7|101/102|d.52.8.2| HM:SCP:REP 28->121|1uwdA_|2.8e-29|48.9|94/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 476 OP:NHOMOORG 388 OP:PATTERN 111-1112222222221111111---------------------------11--11111111111-11 -11--1-1----1---------------------------21111--1-------11-11---1-1----1----111----2----11111111111111111111211--------------------------11111---11--------------------1----------------11112---1-1---------------111111---12211--111111--1111111111111111111113--11-213333221111-12-11111111112222222222222211111111111112221112221----------------------------2------------------1--1-1111111111111223211111122222222222-1121111121111111212111222211111111111111111111111111-11-----------------------------111111------------2222----122222-----2---------11--2--------2-------------1-1------------------------11111---1-11-------------------21-----111-1------------------------1211----------------------------------------------------------------------------------------------11111111111111--------------------------1-----------------111111111---------------11111111111111----111111------------------------------------1111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 75.4 SQ:SECSTR ###########################HHHHHHTTcccTTTcccTTTTTcEEEEEEETTEEEEEEEcccccccccccHHHHHHHHHHHTcTTccEEEEEEcccccccGGGcccGGGTTT### DISOP:02AL 1-23| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEcccEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHccHHHHHHHccc //