[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39699.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   104->134 PF03249 * TSA 0.001 38.7 31/525  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39699.1 GT:GENE ABE39699.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2760124..2760588 GB:FROM 2760124 GB:TO 2760588 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39699.1 GB:DB_XREF GI:91683397 LENGTH 154 SQ:AASEQ MHGRTLRLLFAASIAGCLLVSSVDPGFAANVIITEEEGKLPPPREMPAPSDRGITRGPKIELDADDKVVLRAPLHLKLKFKTYGGSAIDLGALQATYIKEPAVDLTTRLKPFAQQTGIDIPDAQLPPGEHFIQIVIKDSDGRAVTKVFKLKVAP GT:EXON 1|1-154:0| TM:NTM 1 TM:REGION 3->25| HM:PFM:NREP 1 HM:PFM:REP 104->134|PF03249|0.001|38.7|31/525|TSA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHHcccccccccEEEEEcHHcccccccccccccccccccccEEEEEEcccEEEcccEEEEEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEcc //