[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39702.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->57 PF04290 * DctQ 0.0009 24.5 53/133  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39702.1 GT:GENE ABE39702.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2762857..2763045) GB:FROM 2762857 GB:TO 2763045 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39702.1 GB:DB_XREF GI:91683400 LENGTH 62 SQ:AASEQ MRTLFLTIGIIAVLMGLVWTGQGLGYINWPESSFMLKQTQWAYYGATTAIGGLVLILISRKA GT:EXON 1|1-62:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 42->59| HM:PFM:NREP 1 HM:PFM:REP 4->57|PF04290|0.0009|24.5|53/133|DctQ| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111------------------------------1---1----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,62-63| PSIPRED ccEEEEEHHHHHHHHHHHHcccccEEEcccHHHHHHHHccEEEHHHHHHHHHHEEEEEEccc //