[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39705.1
DDBJ      :             ABC-type branched-chain amino acid transport systems, periplasmic component
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  179/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->403 3i09A PDBj 1e-87 50.4 %
:RPS:PDB   29->373 3eafA PDBj 1e-24 14.8 %
:RPS:SCOP  27->342 1usgA  c.93.1.1 * 3e-39 16.5 %
:HMM:SCOP  28->403 1qo0A_ c.93.1.1 * 5.7e-80 29.2 %
:RPS:PFM   51->336 PF01094 * ANF_receptor 1e-20 31.6 %
:HMM:PFM   50->335 PF01094 * ANF_receptor 2.2e-10 17.5 285/348  
:BLT:SWISS 30->323 LIVB6_BRUME 1e-11 29.5 %
:BLT:SWISS 299->374 ENO_PETMO 9e-04 32.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39705.1 GT:GENE ABE39705.1 GT:PRODUCT ABC-type branched-chain amino acid transport systems, periplasmic component GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2765956..2767173 GB:FROM 2765956 GB:TO 2767173 GB:DIRECTION + GB:PRODUCT ABC-type branched-chain amino acid transport systems, periplasmic component GB:PROTEIN_ID ABE39705.1 GB:DB_XREF GI:91683403 LENGTH 405 SQ:AASEQ MKTRTLLAAAAMTMSVTTAARAQVSDDAVRIGVLTDHSGGFAHLVGKRSVDAAQMAVDDFGGKVLGKPISVITADHQNKADIASALSRKWFETEGVDAITDVAGSAVALATQEIARSRNKIVLVSGAATTELTGKACSATTTQWSYDTYALAKGTAAQVTKQGNGASWFFLTSDYAFGHSLQNEASRFVEANGGKVVGAVRFPFGSSDFSSFLLQGQASKAKVIGLAMSGADLISAIKQAGEFGIVQSGQSLAGLAIYINDVEGLGLKTAQGLTLTTSFYWDMNDETRSWAKRYMERSGGFIPNFITAGTYASVMHYLKAVQAAGTDEGTAVAAKMRDMPVNDFYNKDVAIRVDGRVMHKTFLMEVKKPAESKYRGDYYKVLAEMSGDESFRPLSESQCPLVKSK GT:EXON 1|1-405:0| BL:SWS:NREP 2 BL:SWS:REP 30->323|LIVB6_BRUME|1e-11|29.5|278/390| BL:SWS:REP 299->374|ENO_PETMO|9e-04|32.9|73/100| SEG 3->22|trtllaaaamtmsvttaara| BL:PDB:NREP 1 BL:PDB:REP 27->403|3i09A|1e-87|50.4|359/361| RP:PDB:NREP 1 RP:PDB:REP 29->373|3eafA|1e-24|14.8|337/379| RP:PFM:NREP 1 RP:PFM:REP 51->336|PF01094|1e-20|31.6|275/319|ANF_receptor| HM:PFM:NREP 1 HM:PFM:REP 50->335|PF01094|2.2e-10|17.5|285/348|ANF_receptor| RP:SCP:NREP 1 RP:SCP:REP 27->342|1usgA|3e-39|16.5|310/345|c.93.1.1| HM:SCP:REP 28->403|1qo0A_|5.7e-80|29.2|366/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 520 OP:NHOMOORG 187 OP:PATTERN ------------------------4--21--1--------------------------------1--- -------1111----------2---1------1111-111------------1-------111-------------------1------------------------------------------------------11-----231------11--------1-------------------11----------------------------------1-1----------1------------------------------------------------------------------------------------------1---1--------------------1--1-----------------2--------------11-LJH2-3B5FD622222212215-23H21N2A----3111223333217A---3151211222111111114----2-1-----------------------------------464381222311111111331111111263A641133342334679359----1-1------------322-2------11----------1---112------------------------------------21---------------------------------------1----------------------------------------------------------------------------------------------1111--------------------------1-----1-1-111-32-1------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 375 STR:RPRED 92.6 SQ:SECSTR #######################EEccEEEEEEEEccccTTHHHcHHHHHHHHHHHHHHHEEcTTccEEEEEEEEcTTcHHHHHHHHHHHHHTTcccEEEEcccHHHHHHHHHHHHHHTcEEEEccccGGGTTcTTETEEcccccHHHHHHHHHHHHHHHHccEEEcEEEEcTTcHHHHTTHHHHHHHTGGGTEEEEEEEEccTTccHHHHHHHHHHTTcccEEEEcccHHHHHHHHHHHHHHTccTccEEEEcGGGccTTHHHHHcGGGTTcEEEEEccccGGcTTcHHHHHHHHHHcGGGccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcccccTTccccccccccccEEEEEEcTTccEEcTTccEEEEEEEcHHHHcccTTTcc####### DISOP:02AL 1-3,405-406| PSIPRED ccHHHHHHHHHHHHEEEHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccEEEEcccccccccEEEEEEEccccccccccHHHEEEEccHHHccccHHHccccccccc //