[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39713.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39713.1 GT:GENE ABE39713.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2775186..2775458 GB:FROM 2775186 GB:TO 2775458 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39713.1 GB:DB_XREF GI:91683411 LENGTH 90 SQ:AASEQ MGNLDLNYKGKFVVYFGRERRGRLFDFFEGRGRGPKYRFVFADIPGEVTTEKLAGSALDAPLLQVFKRRVNGDVPQPAAASPTVVALNPR GT:EXON 1|1-90:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4,90-91| PSIPRED cccccccccccEEEEEcccccccHHHHHccccccccEEEEEEcccccccHHHHccccccHHHHHHHHHHHccccccccccccEEEEEccc //