[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39718.1
DDBJ      :             N-acetyl-gamma-glutamyl-phosphate reductase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  636/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->330 1xygA PDBj 2e-24 35.3 %
:RPS:PDB   21->321 1brmC PDBj 2e-22 12.9 %
:RPS:SCOP  21->143 1vknA1  c.2.1.3 * 8e-11 27.0 %
:RPS:SCOP  135->305 1vknA2  d.81.1.1 * 2e-32 22.8 %
:RPS:SCOP  292->331 1vknA1  c.2.1.3 * 3e-04 42.5 %
:HMM:SCOP  18->167 2cvoA1 c.2.1.3 * 1.1e-28 35.6 %
:HMM:SCOP  135->305 2cvoA2 d.81.1.1 * 3.4e-44 36.9 %
:RPS:PFM   64->116 PF01118 * Semialdhyde_dh 3e-04 44.0 %
:RPS:PFM   141->256 PF01499 * Herpes_UL25 7e-04 29.6 %
:HMM:PFM   30->123 PF01118 * Semialdhyde_dh 5e-13 31.9 91/121  
:BLT:SWISS 21->330 ARGC_CAUCR 2e-86 54.9 %
:PROS 130->146|PS01224|ARGC

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39718.1 GT:GENE ABE39718.1 GT:PRODUCT N-acetyl-gamma-glutamyl-phosphate reductase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2780757..2781752 GB:FROM 2780757 GB:TO 2781752 GB:DIRECTION + GB:PRODUCT N-acetyl-gamma-glutamyl-phosphate reductase GB:PROTEIN_ID ABE39718.1 GB:DB_XREF GI:91683416 InterPro:IPR000534 InterPro:IPR000706 InterPro:IPR010136 LENGTH 331 SQ:AASEQ MTLTDTTTNQAAASQRAKLVVFIDGAAGTTGLGIRERLGRNGEVVVMDIADDKRKDVAAKRALMAEVDLVILCLPDDAAKETVALIDAMGGEAPKVLDASTAFRVAPDWTYGFPELAPDQADKISVARKVSNPGCYPTGGVALLRPLVDAALLPADYPVTINAVSGYSGGGKAMIAAYEAGTAPAFELYGLGFAHKHLPETQLYARLTRRPIFVPSVGNFRQGMLVSVPLHLDTLPGRPAVADLQAALEQRYAGSAYVSVLPQGSAPITDGRIEPEALNETNKLELCVFGSDAHRQAVLVARLDNLGKGASGAAVQNMRLMLGLPDAPGLE GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 21->330|ARGC_CAUCR|2e-86|54.9|304/317| PROS 130->146|PS01224|ARGC|PDOC00941| BL:PDB:NREP 1 BL:PDB:REP 57->330|1xygA|2e-24|35.3|258/345| RP:PDB:NREP 1 RP:PDB:REP 21->321|1brmC|2e-22|12.9|295/359| RP:PFM:NREP 2 RP:PFM:REP 64->116|PF01118|3e-04|44.0|50/120|Semialdhyde_dh| RP:PFM:REP 141->256|PF01499|7e-04|29.6|108/536|Herpes_UL25| HM:PFM:NREP 1 HM:PFM:REP 30->123|PF01118|5e-13|31.9|91/121|Semialdhyde_dh| GO:PFM:NREP 4 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| RP:SCP:NREP 3 RP:SCP:REP 21->143|1vknA1|8e-11|27.0|115/176|c.2.1.3| RP:SCP:REP 135->305|1vknA2|2e-32|22.8|158/163|d.81.1.1| RP:SCP:REP 292->331|1vknA1|3e-04|42.5|39/176|c.2.1.3| HM:SCP:REP 18->167|2cvoA1|1.1e-28|35.6|146/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 135->305|2cvoA2|3.4e-44|36.9|160/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 833 OP:NHOMOORG 777 OP:PATTERN ---1-------------1-----1--------111111111111---1111111-------------- 1111111111111-11111-11111111111111111111111--1---111111-11--1111111-1111111111--11111111111111-----1-1-11111-1---------------1111111111111112111211111--111--111111111111111111111111111111111-111--------1------111111--111111--111--112-111111-1111111-11-1--------------------11--------------------------------------1---------11--1----------1-111---1-1--111111111111-11111---1121111111111111121111111111111111111-1121111111111111111111112111111111111121111111111111111---11111---------------------11111121112222222211122212111111221222211221111112111122111111111111111111111-1111111111--111111111111111-1111-1-111111----------1111-11111111-11111111111111111111111---1111----1-11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------111111111-11-------111111111111111112111122221111---------111111111111111111111111111-11111111111-------------------------------------11--1111111- ----11--------11111111111-1111111111111111111111111131-111111111111111111111111111111111-12111111111121111-11------------------------------------------------------1------2----111171111122111211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 94.3 SQ:SECSTR ###################EEEEEcTTcHHHHHHHHHHEEEcccccTTcTTccccccccTTHHHHTccEEEEcccHHHHHHHHHHHHTTTccccEEEEcccTTTTcTTEEEEcHHHHHHHHHHEEEccHHHHEEEEEEEccTTTcHHHHHHHHHHHHHHHHHTTHHHHHcccccHTTTcccccTTTccccTTcccccccccccccHHHHHHHTTccccccEEEEEEEcccccEEEcccccHHHHHHHHHHHcTTcccccccHHHHHHHHHHHccHHHHTTcccccEEEEEEcTTTEEEEEEEEETTcccccHHHHHHHHHHHTccTTTTcc DISOP:02AL 1-2,4-21,167-179,331-332| PSIPRED cEEcccccccccccccccEEEEEEccccHHHHHHHHHHHccccEEEEEEEcHHHccccccHHHHccccEEEEccccHHHHHHHHHHHHccccccEEEEcccccccccccEEEEEcccHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccHHHHHHHHccccccccccccccccccHHHHHHHHccccEEEEEccEEcccEEEEEEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHcccccEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHccccHHHccc //