[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39749.1
DDBJ      :             aquaporin z, major intrinsic protein (MIP) family
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  251/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
f.19.1
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->75 1rc2B PDBj 3e-15 49.3 %
:RPS:PDB   40->76 2b5fD PDBj 3e-05 24.3 %
:RPS:PDB   57->78 2d57A PDBj 5e-09 31.8 %
:RPS:SCOP  2->78 1j4nA  f.19.1.1 * 2e-12 32.5 %
:HMM:SCOP  1->78 1fx8A_ f.19.1.1 * 3.7e-15 39.5 %
:RPS:PFM   5->75 PF00230 * MIP 5e-09 45.7 %
:HMM:PFM   2->78 PF00230 * MIP 3.1e-18 35.1 77/227  
:BLT:SWISS 1->83 AQPZ_PSEAE 1e-18 51.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39749.1 GT:GENE ABE39749.1 GT:PRODUCT aquaporin z, major intrinsic protein (MIP) family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2819409..2819696 GB:FROM 2819409 GB:TO 2819696 GB:DIRECTION + GB:PRODUCT aquaporin z, major intrinsic protein (MIP) family GB:PROTEIN_ID ABE39749.1 GB:DB_XREF GI:91683447 InterPro:IPR000425 LENGTH 95 SQ:AASEQ MKKPVAEFFGTFALVFFGCGAAVIAGMGAGSTSIDVLGIAFAFGLAIVAMAYGIGPVSGCYVNPAVGFGVLLAGRMTIDLFSPARCGLHVLAARN GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|AQPZ_PSEAE|1e-18|51.2|82/229| TM:NTM 2 TM:REGION 5->27| TM:REGION 44->66| BL:PDB:NREP 1 BL:PDB:REP 2->75|1rc2B|3e-15|49.3|73/231| RP:PDB:NREP 2 RP:PDB:REP 40->76|2b5fD|3e-05|24.3|37/230| RP:PDB:REP 57->78|2d57A|5e-09|31.8|22/224| RP:PFM:NREP 1 RP:PFM:REP 5->75|PF00230|5e-09|45.7|70/227|MIP| HM:PFM:NREP 1 HM:PFM:REP 2->78|PF00230|3.1e-18|35.1|77/227|MIP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00230|IPR000425| GO:PFM GO:0006810|"GO:transport"|PF00230|IPR000425| GO:PFM GO:0016020|"GO:membrane"|PF00230|IPR000425| RP:SCP:NREP 1 RP:SCP:REP 2->78|1j4nA|2e-12|32.5|77/249|f.19.1.1| HM:SCP:REP 1->78|1fx8A_|3.7e-15|39.5|76/254|f.19.1.1|1/1|Aquaporin-like| OP:NHOMO 342 OP:NHOMOORG 303 OP:PATTERN ---------------------------------1--------1111---------------------- -11-----------1----------1-------1111111-------1---------1----1------------------1--------1----------1-------1--------------11--11----------------1-111------------11------------------1------1---11111-21-112--1------111----------------------------------21-1--------11----1-111-----------1---1111111111-------------------------------------------------------------------------1-11--------111-11111-2--11111111111-1221211-1---122-11-11112-1-1---111111-1------------------------------------------------11--11--111111-11111111111111111---1--------------1--1--11-1-----------------------------1-1------11-111-1-1-------------------------11----1-----111----111--111--1-------------11---1-1111111111-1111111111111111111111--11-----------------11111111--1-----------------------------1111-1---------111111----1-11111111-1111--------------1111-----1111111--------------------------------1-------------------------------------- --------------------------------------------------------------------------------------------------------------1------1-1-11111132232-221-21111221111211---1--21---21---2124--1-----------5113-14------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 85.3 SQ:SECSTR HTHHHHHHHHHHHHHHHHHHHHHHTTcTcTTTccHHHHHcHHHHHHHHHHHHHHTTHHcccccHHHHHHHHHHccccH####cTT########## DISOP:02AL 95-96| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHccc //