[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39753.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->88 PF00732 * GMC_oxred_N 0.00025 25.9 54/298  
:HMM:PFM   78->125 PF06781 * UPF0233 0.00075 19.1 47/87  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39753.1 GT:GENE ABE39753.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2824386..2824841 GB:FROM 2824386 GB:TO 2824841 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39753.1 GB:DB_XREF GI:91683451 LENGTH 151 SQ:AASEQ MPKRYRILVGFAFGAALLTGAADPSAALPAVTNGAVLTQDRSDGVIVVRAGGKNRNVNVNRNVNRNTNINRNVNRNANVNVRKNTNVNVNVRRPVRVWAPRPYYGTIVAGVALGTVIYVAAAGTPPAAPSSTLCWYWTDPAMTGGYWDYCR GT:EXON 1|1-151:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 103->124| SEG 10->22|gfafgaalltgaa| SEG 47->97|vvraggknrnvnvnrnvnrntninrnvnrnanvnvrkntnvnvnvrrpvrv| SEG 120->132|aaagtppaapsst| HM:PFM:NREP 2 HM:PFM:REP 35->88|PF00732|0.00025|25.9|54/298|GMC_oxred_N| HM:PFM:REP 78->125|PF06781|0.00075|19.1|47/87|UPF0233| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEEEHHHHHHHHcccccccccccccccEEEEEcccccEEEEEcccccccEEccccccccccccccccccccEEEEEcccEEEEEcccEEEEEcccccHHHHHHHHHHHHHEEEccccccccccccEEEEEccHHHccccccccc //