[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39771.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->70 PF09534 * Trp_oprn_chp 0.00011 24.2 62/189  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39771.1 GT:GENE ABE39771.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2842268..2842600) GB:FROM 2842268 GB:TO 2842600 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39771.1 GB:DB_XREF GI:91683469 LENGTH 110 SQ:AASEQ MKLPTLAMALIAAAVIIFAAKSSKHEETSSGVATVQSAAVPVSPVKTLASATCASDGCPVSCESGDTLLSAICVSGSRARFADTLRVDKGVLTATCGTSAGNILVYCGRP GT:EXON 1|1-110:0| TM:NTM 1 TM:REGION 1->20| SEG 7->20|amaliaaaviifaa| HM:PFM:NREP 1 HM:PFM:REP 5->70|PF09534|0.00011|24.2|62/189|Trp_oprn_chp| OP:NHOMO 19 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------43444------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,22-37| PSIPRED cccHHHHHHHHHHHHHHHEEcccccccccccEEEEEcccccccccEEEccccccccccEEcccccccEEEEEEEccccEEEEEEEEEEccEEEEEEcccccEEEEEEccc //