[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39779.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
:247 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39779.1 GT:GENE ABE39779.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2848236..2848979 GB:FROM 2848236 GB:TO 2848979 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39779.1 GB:DB_XREF GI:91683477 LENGTH 247 SQ:AASEQ MSVANSVAYLPTDTLKPVADDVWIVDSGPLSAMGLEVPVRMTVVRLASGEVWLHSPTSCSNHLKAAIERLGPIAHLVAPNIAHWQFVKGWKDRCPDAKTWAVPGLRTRAPVIKSGVVLDQDLGESPPGAWAADLDQLLITGGFGVNEVAFFHRATKTLILTDFVENLEPAKLGPVAGPLAWLAGATSPDGMAPAHYRFAMNRRRDAVRDTARHLLGWRPERVIFAHGSWFETDGTKRLRHSLRWLLG GT:EXON 1|1-247:0| OP:NHOMO 119 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------1--------------------------1-----------------------------------------------------------------------1--111---111-------------11-111111-1-1-------2-------1-1---------------------------------------------------------------1----------------------------------------------------------------1-----------------------------23----------------------------------------11111----------1--1--------------------------------------------------------------------------------------------------------------11-1--------------------------------------------1------------1----------------------------------------------------------------------------------- --------------11-11-11-----1111111-11111111------11--------------------------------------112-111-----11-----4-------------------------------------------------------------------112F222131--1-3122----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccHHHHccccccEEEEEEEEEHHcEEEcccEEEEEEEccccEEEEccccccHHHHHHHHHHccEEEEEcccHHHEEEcHHHHHHccccEEEEccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEEccccEEEEEEEHHccccccccccccccHHccccccccccccEEEEEEEcccHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHcc //