[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39780.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->75 PF08308 * PEGA 7.5e-08 31.9 47/71  
:HMM:PFM   83->109 PF07489 * Tir_receptor_C 0.0002 51.9 27/221  
:HMM:PFM   4->44 PF11839 * DUF3359 0.00035 34.1 41/96  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39780.1 GT:GENE ABE39780.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2849174..2849623 GB:FROM 2849174 GB:TO 2849623 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39780.1 GB:DB_XREF GI:91683478 LENGTH 149 SQ:AASEQ MRLWAGAVSAALLLSGCASVTRGTTENISIASTPSGALASVAGTDAPFSCVTPCVVEVSRSADITVSLSKEGYEPQIIPLTREISGGGGAGFAGNLLLGGVVGMGVDAATGAAMDHKPNPVVVTLQPVPAPPAVAAPVARHRKPRVPVS GT:EXON 1|1-149:0| SEG 5->20|agavsaalllsgcasv| SEG 86->113|ggggagfagnlllggvvgmgvdaatgaa| SEG 120->148|pvvvtlqpvpappavaapvarhrkprvpv| HM:PFM:NREP 3 HM:PFM:REP 26->75|PF08308|7.5e-08|31.9|47/71|PEGA| HM:PFM:REP 83->109|PF07489|0.0002|51.9|27/221|Tir_receptor_C| HM:PFM:REP 4->44|PF11839|0.00035|34.1|41/96|DUF3359| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,147-150| PSIPRED cccHHHHHHHHHHHHcccHHcccccccEEEcccccccEEEEcccccccEEcccEEEEEEccccEEEEEEccccccEEEEEEEEEcccccccccHHHHHHHHHcccccccccccccccccEEEEEEEccccccHHccHHHHHcccccccc //