[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39784.1
DDBJ      :             phosphoesterase, PA-phosphatase related
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   62->255 2akcA PDBj 5e-09 13.1 %
:RPS:SCOP  141->225 1d2tA  a.111.1.1 * 8e-06 26.2 %
:HMM:SCOP  28->256 1d2tA_ a.111.1.1 * 2.2e-30 32.1 %
:RPS:PFM   136->225 PF01569 * PAP2 8e-05 33.3 %
:HMM:PFM   131->247 PF01569 * PAP2 4.4e-25 37.1 116/129  
:HMM:PFM   97->141 PF00124 * Photo_RC 0.00083 37.8 45/257  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39784.1 GT:GENE ABE39784.1 GT:PRODUCT phosphoesterase, PA-phosphatase related GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2860044..2860886 GB:FROM 2860044 GB:TO 2860886 GB:DIRECTION + GB:PRODUCT phosphoesterase, PA-phosphatase related GB:PROTEIN_ID ABE39784.1 GB:DB_XREF GI:91683482 InterPro:IPR000326 LENGTH 280 SQ:AASEQ MRPGEGGGARSYPVELISLIGQSLARLVRAPSHSRRAVASRRWALHMLLLSAVLATAIVILMVAIDAFEIGLMPKRGTPSLWPVKIFTDFGKAAYVLWTLAALMIMVALLLPRLRGVSRAAMIGIGTRVQFVFLAVLAPVLAGEVLKGVIGRGRPFVGGAANPFNFATFSWDEAYSSLPSGHATVAFALAFAVSALFPRLRTIMLAYAIAIALSRLVLLAHHPSDVVAGALLGTIGALAVRYWFAARRLAFAIRPDGAIEPLPGPSWDRVKRVARDAVAP GT:EXON 1|1-280:0| TM:NTM 6 TM:REGION 45->67| TM:REGION 92->113| TM:REGION 126->148| TM:REGION 178->199| TM:REGION 201->223| TM:REGION 225->246| SEG 100->111|laalmimvalll| SEG 183->197|atvafalafavsalf| SEG 226->240|vvagallgtigalav| RP:PDB:NREP 1 RP:PDB:REP 62->255|2akcA|5e-09|13.1|183/218| RP:PFM:NREP 1 RP:PFM:REP 136->225|PF01569|8e-05|33.3|90/132|PAP2| HM:PFM:NREP 2 HM:PFM:REP 131->247|PF01569|4.4e-25|37.1|116/129|PAP2| HM:PFM:REP 97->141|PF00124|0.00083|37.8|45/257|Photo_RC| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01569|IPR000326| GO:PFM GO:0016020|"GO:membrane"|PF01569|IPR000326| RP:SCP:NREP 1 RP:SCP:REP 141->225|1d2tA|8e-06|26.2|80/222|a.111.1.1| HM:SCP:REP 28->256|1d2tA_|2.2e-30|32.1|218/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111111----------------------------11-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 66.4 SQ:SECSTR #############################################################HHHHHHHHHHHHHHTTTcHHHHHHHHHHcccHHHHHHHHHHHHTccccTTTcHHHHHH###########HHHHHHHHHTTTTHHHHHHHccccHHHHHTcccccHHHHHHHHTccccccHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHH###################### DISOP:02AL 1-10,31-39,278-281| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccccccccHHHHHHHHcccccc //