[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39788.1
DDBJ      :             Lysine-arginine-ornithine-binding periplasmic protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  483/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->235 1xt8B PDBj 4e-17 28.1 %
:RPS:PDB   20->253 2a5sA PDBj 5e-34 11.6 %
:RPS:SCOP  25->253 1xt8A1  c.94.1.1 * 5e-35 26.2 %
:HMM:SCOP  24->259 1xt8A1 c.94.1.1 * 6.2e-48 31.3 %
:RPS:PFM   44->196 PF00497 * SBP_bac_3 2e-13 35.4 %
:HMM:PFM   35->249 PF00497 * SBP_bac_3 1.5e-35 29.6 206/225  
:BLT:SWISS 29->338 AAPJ_RHIL3 e-123 64.2 %
:PROS 272->286|PS00359|RIBOSOMAL_L11
:PROS 57->70|PS01039|SBP_BACTERIAL_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39788.1 GT:GENE ABE39788.1 GT:PRODUCT Lysine-arginine-ornithine-binding periplasmic protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2863703..2864719 GB:FROM 2863703 GB:TO 2864719 GB:DIRECTION + GB:PRODUCT Lysine-arginine-ornithine-binding periplasmic protein GB:PROTEIN_ID ABE39788.1 GB:DB_XREF GI:91683486 InterPro:IPR000911 InterPro:IPR001311 InterPro:IPR001638 InterPro:IPR005768 LENGTH 338 SQ:AASEQ MKRVSLAAAVAITACFAAQSAGAQTLKTVKDRGLLSCGVSQGLPGFSAPDDKGNWTGLDVDLCRAVAAAIFDDPSKVKFVPLSAKDRFTALQSGEIDVLSRNTTWTVSRDTSLGVNFAGVSYYDGQGFLVKKALKVNSALELNSASICVQTGTTNEQNVADYFKGNNMKYEVIAFANADEAIKAYESGRCDVFTSDVSQLYAQRLKVTTPADHVVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFALVNAEELGVTQSNVGEMAKSDKPELKRVFGSDGNLGEQLGLTKDWVARIVKATGNYGESFERNVGTGSKLEIARGLNKLWNKGGIMYAPPIR GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 29->338|AAPJ_RHIL3|e-123|64.2|310/341| PROS 272->286|PS00359|RIBOSOMAL_L11|PDOC00310| PROS 57->70|PS01039|SBP_BACTERIAL_3|PDOC00798| SEG 7->18|aaavaitacfaa| BL:PDB:NREP 1 BL:PDB:REP 25->235|1xt8B|4e-17|28.1|203/251| RP:PDB:NREP 1 RP:PDB:REP 20->253|2a5sA|5e-34|11.6|232/278| RP:PFM:NREP 1 RP:PFM:REP 44->196|PF00497|2e-13|35.4|144/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 35->249|PF00497|1.5e-35|29.6|206/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 25->253|1xt8A1|5e-35|26.2|221/248|c.94.1.1| HM:SCP:REP 24->259|1xt8A1|6.2e-48|31.3|227/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 885 OP:NHOMOORG 488 OP:PATTERN ----------------------------------------------------1--------------- ----1-1111111111111-11111211111112222145-1131-1-1-------11--11--531121-11111111---------------------------------------------------------11122-----3423223112211111-12-13323-1111--1112-----------11111112211111111---1111111-----------11--------------------12132131212111111--1-1----1111---11111121211112-------------11122211111-1-2----------1-111---1----1--1-22--------11-1--1------231111116532223122211221222224--141-415321123311211234323---1111122115-------------115-----------------------------1--11-25542555555-122233353444234453637-16632151-412253114----212211111---12---5-32-3114332-----------------2---13222221121111111--2----221-------2--------------------------------32331331222222222-22322222222222212222223311111-11111111111111212322211211111111111---------------1131111-1---------33323-11111-44443446113221445----------11111111111111----------------2-------------------------------------------1----11111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----------------1----2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 319 STR:RPRED 94.4 SQ:SECSTR ###################EEccccccccTTcEEEEEEEEcccccccEEEEEEEEEcHHHHHHHHHHHHHccccccccEETTEEcHHHHHHHTTcccEEcccccccHHHHTTTTEEEccccEEEcEEEEEETTcccccTTcHHHHcEEccTTcHHHHHHHTTcHHHHHHHGGGccccHHHHHHHHHTTcccEEEEEHHHHHHHHHTcTTccEEEEEcccGGGcEEEccEEETTcTTHHHHHHHHHHHHHHTHHHHHHHHTGGGccccHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTccHHHHHHHHcTTGGGcccccccHHHHTTccccccccc DISOP:02AL 1-1,25-25| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEEEccccccEEEcccccEEEEHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccEEEccccccccHHHHcccEEcccccccEEEEEEEcccccccHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHccccccccccc //