[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39793.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39793.1 GT:GENE ABE39793.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2868621..2869121 GB:FROM 2868621 GB:TO 2869121 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39793.1 GB:DB_XREF GI:91683491 LENGTH 166 SQ:AASEQ MRRVPATPRADLSNSQGKSVSRRRSVRALHPPLHSEGWGRAAWREGGEFSRWLRTIAQRLVGAPTAAVLGVGTVLPGAGSTGISPASGAPVQPRKRQPLVVAADGDLLPPGRVIARHNARDAASSRHRQPSWRRRVITPAGDPAFVICPAIRRLAKRPSRTGRRGL GT:EXON 1|1-166:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-26,88-90,92-92,119-131,157-167| PSIPRED ccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHcccHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccccEEEEccccccccccEEEEccccHHHHHHHcccHHHEEEEccccccEEEEEHHHHHHHHcccccccccc //