[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39797.1
DDBJ      :             amine oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  192/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.78.2
:437 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->44 1sezA PDBj 1e-04 46.5 %
:RPS:PDB   2->373 3cnsA PDBj 9e-21 15.1 %
:RPS:SCOP  1->22,148->315 1sezA1  c.3.1.2 * 2e-19 10.8 %
:RPS:SCOP  1->79 1b73A1  c.78.2.1 * 6e-07 20.3 %
:HMM:SCOP  1->419 1o5wA1 c.3.1.2 * 4e-37 28.1 %
:HMM:PFM   10->77 PF01593 * Amino_oxidase 9.6e-06 30.8 65/449  
:HMM:PFM   207->272 PF01593 * Amino_oxidase 3.4e-06 20.0 65/449  
:BLT:SWISS 3->68 YGFK_ECOLI 7e-05 42.4 %
:BLT:SWISS 155->320 UPPS_STRP8 2e-04 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39797.1 GT:GENE ABE39797.1 GT:PRODUCT amine oxidase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2872864..2874177) GB:FROM 2872864 GB:TO 2874177 GB:DIRECTION - GB:PRODUCT amine oxidase GB:PROTEIN_ID ABE39797.1 GB:DB_XREF GI:91683495 InterPro:IPR002937 LENGTH 437 SQ:AASEQ MRVAVVGTGIAGNAAAWALSSRYPVTVYERELRAGGHSHTITVDYDGTAIPVDIGFIVYNQLNYPDLTALFAHLGVETVESCMSFAVSADAGRFEWKGGGSNWLETARGLFAQPSNLLSPSYLKMLRHILVFNEQSVADFKSGALMGMSLGEYFTSRKFAPRLLTDYLAPMGAAIWSAPAAEILDFPAENFVAFFNNHRLLHYERPIWRTVKGGSARYVEKLTAAFKDQMRLGSAVTAIERTPKGVIVRDSHGRSDVYDHVVIGAHSDQALAMLADPSDEERDILGSIGYAPNLVYLHRDPRLMPKRKHAWASWNFLRWKREGSPVNDVAVTYWMNRLQGIDESKPLFVSLNPPFAPDPALTFGRYDCDHPQYTAAAFAAQRRIGEIQGQRRTWFCGAWTGYGFHEDGLRSGLAVADHLGAPVPWRAPPPEVREAAE GT:EXON 1|1-437:0| BL:SWS:NREP 2 BL:SWS:REP 3->68|YGFK_ECOLI|7e-05|42.4|66/1032| BL:SWS:REP 155->320|UPPS_STRP8|2e-04|28.3|152/249| SEG 381->392|qrrigeiqgqrr| BL:PDB:NREP 1 BL:PDB:REP 2->44|1sezA|1e-04|46.5|43/456| RP:PDB:NREP 1 RP:PDB:REP 2->373|3cnsA|9e-21|15.1|345/492| HM:PFM:NREP 2 HM:PFM:REP 10->77|PF01593|9.6e-06|30.8|65/449|Amino_oxidase| HM:PFM:REP 207->272|PF01593|3.4e-06|20.0|65/449|Amino_oxidase| RP:SCP:NREP 2 RP:SCP:REP 1->22,148->315|1sezA1|2e-19|10.8|189/353|c.3.1.2| RP:SCP:REP 1->79|1b73A1|6e-07|20.3|79/105|c.78.2.1| HM:SCP:REP 1->419|1o5wA1|4e-37|28.1|256/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 309 OP:NHOMOORG 276 OP:PATTERN -------------------------------------------------------------------- ----1------------11-1---1-111111-----111-------------11--1----1---2--1-----------------------------------------------------------------------------1----1----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------1-11---11111---------------------11--112-1-211--1-11111-1111111--------1-----11-----------------------------1--1--1----------1----111-------111-1---1---1111111----1-1---111-----------11--11111-------------1--1--------1--------------------------11-111111111111111-111111--1-1----111--------11-11------------------------------11121--------------------------------------------1----------1211---------------2211212111------11111111111111---1111---11-11111111111111111111--------221111------------------------------------------------- ----111-----11111111---1211111211----1-11111111111111111111111---------------------------12111111113-11----12-----------------------------------------------------------------111117111111112121113234- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 436 STR:RPRED 99.8 SQ:SECSTR cEEEEEcccHHHHHHHHHHHTTccEEEEcccccccTTccEEEcGGGcTTEEEEccccEEccTTTcHHHHHHHHHHHHHcccccccEEEcTTccEEccccccEEEETTTEEcTTcTTTcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHTGGGccHHHHHHHHHHGGGGHHHHTccTTTccHHHHHHTTTHHHHHccccccccEEEccTHHHHHHHHTTccGGGETTccEEEEEEETTEEEEEEccccEEEEEEEEEcccHHHHHGGGccccccTTccEEEccccHHHHHHGGGcEEEcHTTcEEEEEEEccccccccccEEEEcccccHHHHHHHHHcccHHHHHHHHHcccccTTcccEEEEEHHTcGGGGcccEEEEEEcTTcTTTcccccccccTTHHHHTGGGTTcccTGGGccccccccccccc# DISOP:02AL 433-438| PSIPRED cEEEEEcccHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEEccccEEEEccccEEcccccHHHHHHHHHHcccccEEEccEEEEcccccEEEEccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHccccEEEccEEEEEEEcccEEEEEEccccEEEccEEEEEccHHHHHHHHccccHHHHHHHHcccccccEEEEEEcccccccccccccccEEEccccccccccccEEEEEHHHHccccccccEEEEcccccccccccEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHccccccccccHHHHcccc //