Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39803.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39803.1 GT:GENE ABE39803.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2884802..2884975) GB:FROM 2884802 GB:TO 2884975 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39803.1 GB:DB_XREF GI:91683501 LENGTH 57 SQ:AASEQ MSEAEYNRLLDEVSHALAEGDQDNDRGVSLVMPMRCAANDNQIEWPLIPFPSGWHAS GT:EXON 1|1-57:0| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,57-58| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccc //