[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39811.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39811.1 GT:GENE ABE39811.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2894824..2895591 GB:FROM 2894824 GB:TO 2895591 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39811.1 GB:DB_XREF GI:91683509 LENGTH 255 SQ:AASEQ MVSLKLVSRCFVVALAAQVLLWPCSRLSAQPAGHGISQQQAEVSLREVAAEFISQQKQGATNDYSTPRVRLYNLVRLYNRDIGWIFVAEFDGALVPVKWMPGEKQKFYHGIIKIVADKNGMPQAPVINEGQGLWESEAKVADLYNDLREDIGQWSDWLGNPMAPPPNPTANTPPQVPNVAGPGPQLTPPVKLPTTPPSNSSGGGNDAIRAQYAEIAEWKKKCDDPNNPNRPKDCEKYYELQRKLMGQIGNTQPKK GT:EXON 1|1-255:0| TM:NTM 1 TM:REGION 3->25| SEG 160->179|npmapppnptantppqvpnv| SEG 184->197|pqltppvklpttpp| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,33-38,58-62,169-170,193-206,223-228,247-248,250-256| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccEEEEEEccccEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccc //