[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39829.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39829.1 GT:GENE ABE39829.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2914917..2915360 GB:FROM 2914917 GB:TO 2915360 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39829.1 GB:DB_XREF GI:91683527 LENGTH 147 SQ:AASEQ MPPRRQVAVAAVLIAVAIGLSSRVALAQATPIDNLNELFAALKQCWRPPQLTPGDPGMQITVLVSFKRDGEILGKPRITFESANTPGADSLVYRIAVMETLQRCTPLPFTQSMGNAVAGRPFTLRFDDRRTLPKPNEKRAWLTTRTS GT:EXON 1|1-147:0| TM:NTM 1 TM:REGION 8->30| SEG 7->18|vavaavliavai| OP:NHOMO 25 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111--11111----------1-11111111-1---11---1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,127-139,146-148| PSIPRED cccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccccEEcccEEEEEcccccHHHHHHHHHHHHHHHHHHccccccHHHHcccccccEEEEEccccccccccccEEEEEEEcc //