[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39833.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->121 PF04606 * Ogr_Delta 0.00026 25.0 44/47  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39833.1 GT:GENE ABE39833.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2918195..2918569) GB:FROM 2918195 GB:TO 2918569 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39833.1 GB:DB_XREF GI:91683531 LENGTH 124 SQ:AASEQ MHCTQQDQVNHIGAALQNRFLRTNAFVLRHRQSSWCIVRATRIVRPLNAEEVTMPAIAEVLSTKASRPAPRGSDLPTCPVCADSMVAAEASAFVKESIVSYLWTCDTCGYGFVTKHSLKRFACN GT:EXON 1|1-124:0| HM:PFM:NREP 1 HM:PFM:REP 77->121|PF04606|0.00026|25.0|44/47|Ogr_Delta| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,63-72| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcHHEEEEccccEEEEEEEHHcccccHHHccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccc //