[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39835.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  199/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:293 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  47->126 1s7bA  f.39.1.1 * 8e-05 22.2 %
:RPS:SCOP  209->281 1s7bA  f.39.1.1 * 6e-05 23.3 %
:HMM:SCOP  43->149 1s7bA_ f.39.1.1 * 1.8e-13 28.6 %
:HMM:SCOP  184->288 1s7bA_ f.39.1.1 * 7.2e-16 26.7 %
:HMM:PFM   22->141 PF00892 * EamA 1.3e-14 22.7 119/126  
:HMM:PFM   162->279 PF00892 * EamA 7.3e-16 23.9 117/126  
:BLT:SWISS 17->277 SAM_RICTY 9e-25 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39835.1 GT:GENE ABE39835.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2918938..2919819) GB:FROM 2918938 GB:TO 2919819 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF6, transmembrane GB:PROTEIN_ID ABE39835.1 GB:DB_XREF GI:91683533 InterPro:IPR000620 LENGTH 293 SQ:AASEQ MTRQPSKSLAALWMAGWLSLMVIIAVAGREASRELNVFQIMELRSVIGFVMMVPLILGAGGFAAMATTRPLPHLARNLVHYGAQLGWFFALTLIPIGQVVAIEFTMPIWIAILAASFLGERLNLWKIAAVALGLVGVVVIVRPATGAVEPGQLIALAAAVGFAVSITLVKSLTRTESTMTIIFWMLVIQSVLGLLPSVYVWQWPSAYVWGWIVVIAFCGTFSHYCLTRALSYADATVVVPMDFLRVPLSATAGWLIYGERLDAYTVLGAALILTGNLLNLRTVRPEPTARDRS GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 17->277|SAM_RICTY|9e-25|28.8|260/294| TM:NTM 8 TM:REGION 8->30| TM:REGION 40->62| TM:REGION 98->120| TM:REGION 124->146| TM:REGION 152->174| TM:REGION 178->200| TM:REGION 206->228| TM:REGION 234->256| SEG 127->141|iaavalglvgvvviv| HM:PFM:NREP 2 HM:PFM:REP 22->141|PF00892|1.3e-14|22.7|119/126|EamA| HM:PFM:REP 162->279|PF00892|7.3e-16|23.9|117/126|EamA| RP:SCP:NREP 2 RP:SCP:REP 47->126|1s7bA|8e-05|22.2|80/106|f.39.1.1| RP:SCP:REP 209->281|1s7bA|6e-05|23.3|73/106|f.39.1.1| HM:SCP:REP 43->149|1s7bA_|1.8e-13|28.6|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 184->288|1s7bA_|7.2e-16|26.7|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 350 OP:NHOMOORG 205 OP:PATTERN -------------------------------------------------------------------- ---------------------------------111------------------------------------------------------------2----------------------------------------11--------1-----11--1-1--1---------11-1--1--1----------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------2113-------333---3223211111111113-1111121122--2442333744541111-48556558A7-----------1-122----------1111111111111111-2-21211-121-1-----------------------1---------1-----1121-1---1---1----------11-----1---------------------------1-----------1-------1---1--11----31--1---------------1-------1--------------------------------------------------------------------------------11111111111----11111-----111------------1---11-1-11---1-3333121111--1-111----------122-111112222222222222221111--1-------------------------------------------------------- -----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------13111---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,281-294| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccc //