[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39838.1
DDBJ      :             antenna complex, alpha/beta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.3.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->47 1nkzA PDBj 7e-19 76.1 %
:RPS:SCOP  2->44 1ijdA  f.3.1.1 * 3e-11 62.8 %
:HMM:SCOP  1->53 1nkzA_ f.3.1.1 * 2.3e-18 58.5 %
:RPS:PFM   5->40 PF00556 * LHC 9e-05 55.6 %
:HMM:PFM   3->42 PF00556 * LHC 5.7e-18 42.5 40/40  
:BLT:SWISS 1->59 LHA5_RHOPA 3e-26 86.4 %
:PROS 25->41|PS00968|ANTENNA_COMP_ALPHA
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39838.1 GT:GENE ABE39838.1 GT:PRODUCT antenna complex, alpha/beta subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2921103..2921282) GB:FROM 2921103 GB:TO 2921282 GB:DIRECTION - GB:PRODUCT antenna complex, alpha/beta subunit GB:PROTEIN_ID ABE39838.1 GB:DB_XREF GI:91683536 InterPro:IPR000066 InterPro:IPR002361 LENGTH 59 SQ:AASEQ MNQGRIWTVVSPTVGLPLLLGSVTVIAILVHAAVLSNTTWFPKYWNGKTAAITSTVNVG GT:EXON 1|1-59:0| BL:SWS:NREP 1 BL:SWS:REP 1->59|LHA5_RHOPA|3e-26|86.4|59/59| PROS 25->41|PS00968|ANTENNA_COMP_ALPHA|PDOC00748| TM:NTM 1 TM:REGION 12->34| BL:PDB:NREP 1 BL:PDB:REP 2->47|1nkzA|7e-19|76.1|46/52| RP:PFM:NREP 1 RP:PFM:REP 5->40|PF00556|9e-05|55.6|36/38|LHC| HM:PFM:NREP 1 HM:PFM:REP 3->42|PF00556|5.7e-18|42.5|40/40|LHC| GO:PFM:NREP 4 GO:PFM GO:0016021|"GO:integral to membrane"|PF00556|IPR000066| GO:PFM GO:0019684|"GO:photosynthesis, light reaction"|PF00556|IPR000066| GO:PFM GO:0030077|"GO:plasma membrane light-harvesting complex"|PF00556|IPR000066| GO:PFM GO:0045156|"GO:electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity"|PF00556|IPR000066| RP:SCP:NREP 1 RP:SCP:REP 2->44|1ijdA|3e-11|62.8|43/46|f.3.1.1| HM:SCP:REP 1->53|1nkzA_|2.3e-18|58.5|53/53|f.3.1.1|1/1|Light-harvesting complex subunits| OP:NHOMO 27 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---44447------------------------------------------1--1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 78.0 SQ:SECSTR #ccTTGGGTccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHc############ DISOP:02AL 1-3,59-60| PSIPRED ccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccEEEEEEEccccc //