[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39882.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->118 PF06930 * DUF1282 0.00026 24.1 83/170  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39882.1 GT:GENE ABE39882.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2969847..2970227 GB:FROM 2969847 GB:TO 2970227 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39882.1 GB:DB_XREF GI:91683580 LENGTH 126 SQ:AASEQ MSVPKNVYWFEVLLLVSLMLDCISVAFQDRTMDAELSSSVVAAANTIAAGLIMLLAYLVWLAAHGRKNWARAVLTASLVFSVVALAQIVGDGGLDAGLLIDIVSCALTGAGIYLSYTGDARGWFTG GT:EXON 1|1-126:0| TM:NTM 4 TM:REGION 6->28| TM:REGION 38->60| TM:REGION 69->91| TM:REGION 103->125| SEG 88->103|ivgdggldagllidiv| HM:PFM:NREP 1 HM:PFM:REP 33->118|PF06930|0.00026|24.1|83/170|DUF1282| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,126-127| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEccccccccc //