[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39899.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:77 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->52 1ub4C  b.129.1.1 * 4e-04 22.4 %
:HMM:PFM   7->56 PF04014 * SpoVT_AbrB 9.8e-10 27.3 44/47  
:BLT:SWISS 4->63 YPFU_ECOLI 1e-15 54.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39899.1 GT:GENE ABE39899.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2983993..2984226) GB:FROM 2983993 GB:TO 2984226 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39899.1 GB:DB_XREF GI:91683597 LENGTH 77 SQ:AASEQ MASSTVFTSNRSQAVRLPKGVAFPDGVHKVDILKIGRSRVIVPQGQRWDDFFLNGPRASGDFLIEREQPQAEEREPL GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 4->63|YPFU_ECOLI|1e-15|54.2|59/75| SEG 65->76|ereqpqaeerep| HM:PFM:NREP 1 HM:PFM:REP 7->56|PF04014|9.8e-10|27.3|44/47|SpoVT_AbrB| RP:SCP:NREP 1 RP:SCP:REP 4->52|1ub4C|4e-04|22.4|49/75|b.129.1.1| OP:NHOMO 54 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------1--------1---------------11---1----------------------------------------------------------------------1---1--------------------------1--1-----------------------------------------------------------11-------1-------------------------1-----------11--1--------1-----1-1-1-1------------1----1--11-1---112111-1-11-----1-----------------------------111----1111---------------1----1-------1-1-1------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,66-78| PSIPRED cEEEEEEEEcccEEEEccHHHcccccccEEEEEEEccEEEEEEccccHHHHHHcccccccccccccccccHHHHccc //