[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39905.1
DDBJ      :             NusB antitermination factor
Swiss-Prot:NUSB_RHOPS   RecName: Full=N utilization substance protein B homolog;         Short=Protein nusB;

Homologs  Archaea  0/68 : Bacteria  476/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.79.1
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->171 1baq- PDBj 1e-13 32.3 %
:RPS:PDB   29->171 3d3cA PDBj 2e-30 32.3 %
:RPS:SCOP  29->171 1tztA  a.79.1.1 * 2e-31 29.1 %
:HMM:SCOP  28->163 1eyvA_ a.79.1.1 * 1e-35 36.9 %
:RPS:PFM   32->164 PF01029 * NusB 7e-14 39.7 %
:HMM:PFM   32->165 PF01029 * NusB 3e-35 34.1 132/134  
:BLT:SWISS 26->174 NUSB_RHOPS 2e-82 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39905.1 GT:GENE ABE39905.1 GT:PRODUCT NusB antitermination factor GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2988844..2989368 GB:FROM 2988844 GB:TO 2989368 GB:DIRECTION + GB:PRODUCT NusB antitermination factor GB:PROTEIN_ID ABE39905.1 GB:DB_XREF GI:91683603 InterPro:IPR006027 InterPro:IPR011605 LENGTH 174 SQ:AASEQ MVEPKKPFMRKPPPKTGDKKPGDRKANRRGAARLAAVQALYQMDIGGAGIDDTFAEFESHWIGNEVEGDQYLPAEAAFFRDIVSGVVRDQTKLDPLIDEALAKGWPLARIDAIIRAVMRAGAYELEHRKDIPARVVVSEYVDVAHAFVEKDETGMVNAVLDQIARQFRADEFTK GT:EXON 1|1-174:0| SW:ID NUSB_RHOPS SW:DE RecName: Full=N utilization substance protein B homolog; Short=Protein nusB; SW:GN Name=nusB; OrderedLocusNames=RPD_2676; SW:KW Complete proteome; Transcription; Transcription regulation;Transcription termination. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 26->174|NUSB_RHOPS|2e-82|100.0|149/174| GO:SWS:NREP 3 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006353|"GO:transcription termination"|Transcription termination| SEG 4->25|pkkpfmrkpppktgdkkpgdrk| BL:PDB:NREP 1 BL:PDB:REP 29->171|1baq-|1e-13|32.3|133/139| RP:PDB:NREP 1 RP:PDB:REP 29->171|3d3cA|2e-30|32.3|133/138| RP:PFM:NREP 1 RP:PFM:REP 32->164|PF01029|7e-14|39.7|121/124|NusB| HM:PFM:NREP 1 HM:PFM:REP 32->165|PF01029|3e-35|34.1|132/134|NusB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01029|IPR006027| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01029|IPR006027| RP:SCP:NREP 1 RP:SCP:REP 29->171|1tztA|2e-31|29.1|134/141|a.79.1.1| HM:SCP:REP 28->163|1eyvA_|1e-35|36.9|130/131|a.79.1.1|1/1|NusB-like| OP:NHOMO 477 OP:NHOMOORG 476 OP:PATTERN -------------------------------------------------------------------- 1---1-1-111-1-------------------------------1---111------------11-11-----------1-1------------------------------------------------------1111-111----------------------------------------------1-1111111111111111111111111111111111111111-----------------------1--------------1--11----11111-1111--------------------------1111111-1-------------11----111--1--1--1-11-1---111---1------111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------1-1111111111111----1111111111-------1111111111-11111-1-------1----11111-11---1----1-------111--1-111-1---11--1-111111111111111-1----------------------1----1111111111111111111111111111111--1-1111----11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111--1111111-----1111111--1-----1--1----------1111111111111111111-11111111111111111111-1111111111111111---1--11111--1111111--------------------------111--111---11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 82.2 SQ:SECSTR ############################HHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccTTccTcccccccHHHHHHHHHHHHTcHHHHHHHHGGGTTccTccccccHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHcTTc### DISOP:02AL 1-32,168-175| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHcc //