[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39914.1
DDBJ      :             phosphate:acyl-[acyl carrier protein] acyltransferase
Swiss-Prot:PLSX_RHOPS   RecName: Full=Fatty acid/phospholipid synthesis protein plsX;

Homologs  Archaea  0/68 : Bacteria  740/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.77.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->316 1u7nA PDBj 2e-32 34.4 %
:RPS:SCOP  6->335 1u7nA  c.77.1.4 * 2e-96 34.2 %
:HMM:SCOP  4->342 1vi1A_ c.77.1.4 * 1.6e-102 45.3 %
:RPS:PFM   6->330 PF02504 * FA_synthesis 3e-74 48.4 %
:HMM:PFM   5->327 PF02504 * FA_synthesis 6.8e-101 41.4 319/323  
:BLT:SWISS 1->353 PLSX_RHOPS 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39914.1 GT:GENE ABE39914.1 GT:PRODUCT phosphate:acyl-[acyl carrier protein] acyltransferase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3000589..3001650 GB:FROM 3000589 GB:TO 3001650 GB:DIRECTION + GB:PRODUCT phosphate:acyl-[acyl carrier protein] acyltransferase GB:PROTEIN_ID ABE39914.1 GB:DB_XREF GI:91683612 InterPro:IPR003664 LENGTH 353 SQ:AASEQ MPQKVRIALDAMGGDFGPSVVIPGAAIALGRHPDAEFLLFGDSALIDKELAAHPALKKVSRVVHTDVAVSMHDKPSQALRRGRKVSSMWLAIEAVKKGEADVAVSAGNTGALMAMARFCLRTLPGIDRPAIAATWPTVRGDSVVLDLGATIGGDAAHLKALAVMGAAMASVLFDLERPTVGLLNIGVEEIKGGEEIREAAELLRAMQSPPFEFIGFVEGDGIGSGAADVIVSEGFSGNIALKAAEGTARQIIQLLRDAMSRTWSAKIGYLFARGAFRALRDKIDPNKSNGGVFLGLNGIVVKSHGGTNADGFAYAVDVSYDMVRYDLLTKINQTLNRETGALVSTPSAQEAVS GT:EXON 1|1-353:0| SW:ID PLSX_RHOPS SW:DE RecName: Full=Fatty acid/phospholipid synthesis protein plsX; SW:GN Name=plsX; OrderedLocusNames=RPD_2685; SW:KW Complete proteome; Fatty acid biosynthesis; Lipid synthesis;Phospholipid biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->353|PLSX_RHOPS|0.0|100.0|353/353| GO:SWS:NREP 3 GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0008654|"GO:phospholipid biosynthetic process"|Phospholipid biosynthesis| TM:NTM 1 TM:REGION 155->177| SEG 185->205|igveeikggeeireaaellra| BL:PDB:NREP 1 BL:PDB:REP 6->316|1u7nA|2e-32|34.4|285/305| RP:PFM:NREP 1 RP:PFM:REP 6->330|PF02504|3e-74|48.4|322/323|FA_synthesis| HM:PFM:NREP 1 HM:PFM:REP 5->327|PF02504|6.8e-101|41.4|319/323|FA_synthesis| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02504|IPR003664| GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF02504|IPR003664| RP:SCP:NREP 1 RP:SCP:REP 6->335|1u7nA|2e-96|34.2|313/318|c.77.1.4| HM:SCP:REP 4->342|1vi1A_|1.6e-102|45.3|333/0|c.77.1.4|1/1|Isocitrate/Isopropylmalate dehydrogenase-like| OP:NHOMO 747 OP:NHOMOORG 742 OP:PATTERN -------------------------------------------------------------------- 1111--------------------------------------1-----------------11--------1-------1111111111-----------------1111111111111111111111111111111-----1111-111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111-11-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111211111111111111111111111111111111111111111111111111111111111111----1111111111111111111111112--1111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1111111111111111111111----1--1----------1111111111111111111111111111111111111111111--------------1111-1-111----------111111-1111111---1111111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 306 STR:RPRED 86.7 SQ:SECSTR ####EEEEEEc#ccTTTTHHHHHHHHHHHHHcTTcEEEEEEcHHHHHTTccc###ccTTEEEEEccccccTTccHHHHHHH#cTTcHHHHHHHHHHHTcccEEEEcccHHHHHHHHHHTTcccTTccccEEEcEEEcTcTTcEEEcccccccccHHHHHHHHHHHHHHHHHTTccccccEEEEccccccHHHHHHHHHHHHHHHHcTcTTccEEEEEcGGGGGGccccEEEccHHHHHHHHHHHHHHHHHHHHH#HHHTTcccHHTccHHHHHHHHHHHHHHHcGGGGccEEEETccccEEEccTTccHHHHHHHH##################################### DISOP:02AL 1-2,337-354| PSIPRED cccEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHccccccccEEEccHHHcccccHHHHHHHHcccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHcccHHHHHHHHHHHHHHccccccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHcccEEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHcc //