[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39918.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->136 PF05334 * DUF719 0.00035 24.2 66/181  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39918.1 GT:GENE ABE39918.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3004164..3004595 GB:FROM 3004164 GB:TO 3004595 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39918.1 GB:DB_XREF GI:91683616 LENGTH 143 SQ:AASEQ MRLRVRKAAHFLERTGLALAGAACGTFVGAHVGTSVGALTTVAFLLAMIAVGAIGFYLGIDIPPLPFQAGESEAEHAERGKVDAAEFLSAVGTFFATLAAFASVSLVVLHLSSHVFWTGLIIIGWLGGVTMQIVAGAIARMRR GT:EXON 1|1-143:0| TM:NTM 3 TM:REGION 28->50| TM:REGION 86->108| TM:REGION 118->140| SEG 16->23|glalagaa| SEG 93->116|tffatlaafasvslvvlhlsshvf| SEG 119->128|gliiigwlgg| HM:PFM:NREP 1 HM:PFM:REP 70->136|PF05334|0.00035|24.2|66/181|DUF719| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,72-77,143-144| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //