[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39936.1
DDBJ      :             LSU ribosomal protein L13P
Swiss-Prot:RL13_RHOPS   RecName: Full=50S ribosomal protein L13;

Homologs  Archaea  0/68 : Bacteria  908/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->143 2i2tJ PDBj 2e-47 59.9 %
:RPS:PDB   5->141 3d5bN PDBj 3e-42 47.1 %
:RPS:SCOP  1->141 1vs6J1  c.21.1.1 * 4e-58 60.0 %
:HMM:SCOP  15->152 1j3aA_ c.21.1.1 * 9.8e-44 51.2 %
:RPS:PFM   15->141 PF00572 * Ribosomal_L13 1e-39 62.7 %
:HMM:PFM   15->142 PF00572 * Ribosomal_L13 4.3e-54 56.7 127/128  
:BLT:SWISS 1->154 RL13_RHOPS 1e-87 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39936.1 GT:GENE ABE39936.1 GT:PRODUCT LSU ribosomal protein L13P GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3023110..3023574 GB:FROM 3023110 GB:TO 3023574 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L13P GB:PROTEIN_ID ABE39936.1 GB:DB_XREF GI:91683634 InterPro:IPR005822 InterPro:IPR005823 LENGTH 154 SQ:AASEQ MKTFSAKPAEVTKKWVIIDATGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNIIIINAAKVVLTGRKRDNKVYYHHTGFIGGIKERTAKSILEGRFPERVVEKAVERMIPRGPLGRVQMGNLRVYGGAEHPHEAQQPEPLDVAAMNRKNMRAA GT:EXON 1|1-154:0| SW:ID RL13_RHOPS SW:DE RecName: Full=50S ribosomal protein L13; SW:GN Name=rplM; OrderedLocusNames=RPD_2707; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->154|RL13_RHOPS|1e-87|100.0|154/154| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| TM:NTM 1 TM:REGION 15->35| BL:PDB:NREP 1 BL:PDB:REP 1->143|2i2tJ|2e-47|59.9|142/142| RP:PDB:NREP 1 RP:PDB:REP 5->141|3d5bN|3e-42|47.1|136/137| RP:PFM:NREP 1 RP:PFM:REP 15->141|PF00572|1e-39|62.7|126/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 15->142|PF00572|4.3e-54|56.7|127/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 1->141|1vs6J1|4e-58|60.0|140/140|c.21.1.1| HM:SCP:REP 15->152|1j3aA_|9.8e-44|51.2|125/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 1129 OP:NHOMOORG 1071 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-1---211-111-11111111111-1111-11111111-111111111111-1111111111111111-111111111111-11111111111111112-141-111-121-1111111-1-121-1-11-1-1111111--11-11---1211-1211-1111--111222M2222242541321121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 96.1 SQ:SECSTR cccccccccccccccEEEccTTccHHHHHHHHHHHHTGGGcTTccTTTcccccEEEcccTTccccccTTTTcEEEcccccTTcccEEEHHHHHHHccTHHHHHHHHHHHccccHHHHHHHHTEEEcccccccccccccEEcccGcGGG###### DISOP:02AL 1-2,146-155| PSIPRED cccEEccHHHEEEEEEEEEcccccHHHHHHHHHHHHccccccEEccccccccEEEEEccccEEEEcccccEEEEEEccccccccccccHHHHHHcccHHHHHHHHHHccccccHHHHHHHHcccccccccccHHccccEEEEcccccccccccc //